6KEY: SPRY domain-containing SOCS box protein 2

Structural basis for the regulation of inducible nitric oxide synthase (iNOS) by the SPRY domain-containing SOCS box protein 2 (SPSB2). Determined by X-ray diffraction at 1.24 Å resolution. Released 1 Jul 2020.

Method: X-ray diffraction
Resolution: 1.24 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,724
Mol. weight: 23.97 kDa
Released: 1 Jul 2020

Explore 6KEY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KEY contains 9 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	22-24	3
α-helix	26	1
α-helix	29-34	6
α-helix	36-38	3
α-helix	40-45	6
β-strand	48-53	6	1
β-strand	57-60	4	2
α-helix	61-63	3
β-strand	65-68	4	2
β-strand	71	1	3
β-strand	75-80	6	1
β-strand	84	1	4
β-strand	88-94	7	2
α-helix	97-99	3
β-strand	105-109	5	1
β-strand	116-117	2	1
β-strand	130-134	5	1
β-strand	139	1	5
β-strand	140-141	2	1
α-helix	149-150	2
β-strand	151	1	5
α-helix	161-163	3
β-strand	166-172	7	2
β-strand	177-182	6	2
β-strand	185-191	7	2
β-strand	199	1	4
β-strand	200-205	6	1
β-strand	211-219	9	2

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	7	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SPRY domain-containing SOCS box protein 2	A	protein	209	Homo sapiens	Q99619 (AlphaFold model)
Nitric oxide synthase, inducible	B	protein	9	Homo sapiens	P35228 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6KEY_1 SPRY domain-containing SOCS box protein 2 (chains A)
MGDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRPVAQSTDGAR
GKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHYAALLGSNSESWGWDIGRGK
LYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGGTYLGPAFRGLKGRTL
YPAVSAVWGQCQVRIRYLGERGSHHHHHH

Sequence of entity 2 (B), FASTA

>6KEY_2 Nitric oxide synthase, inducible (chains B)
KDINNNVEK

Primary citation

Structural basis for the regulation of inducible nitric oxide synthase by the SPRY domain-containing SOCS box protein SPSB2, an E3 ubiquitin ligase. Li, K., You, T., Zhao, P. et al. Nitric Oxide (2021) 113-114:1-6. DOI 10.1016/j.niox.2021.04.004 · PubMed

Other PDB entries of the same protein (UniProt Q99619 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JWM 1.23 Å, Crystal structure of the SPRY domain of SPSB2 in complex with cR7, a potent cyclic…
5XN3 1.34 Å, Crystal structure of SPSB2 in complex with a rational designed RGD containing cyclic…
6DN6 1.59 Å, SPRY domain-containing SOCS box protein 2 complexed with INNN(ABU) cyclic peptide…
6JWN 1.61 Å, Crystal structure of the SPRY domain of SPSB2 in complex with cR9, a cyclic peptide…
9RV5 1.75 Å, Crystal structure of SPSB2 SPRY domain in complex with linear TAT peptide
3EMW 1.8 Å, Crystal Structure of human splA/ryanodine receptor domain and SOCS box containing 2…
6JKJ 1.9 Å, Crystal structure of human SPSB2 in the apo-state
6DN5 2.4 Å, SPRY domain-containing SOCS box protein 2 complexed with WDINNN(BAL) cyclic peptide…

Browse structure collections

About this viewer

MolViewer shows 6KEY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.