Structural basis for the regulation of inducible nitric oxide synthase (iNOS) by the SPRY domain-containing SOCS box protein 2 (SPSB2). Determined by X-ray diffraction at 1.24 Å resolution. Released 1 Jul 2020.
Explore 6KEY in 3D Show helices and sheets RCSB PDB PDBe
6KEY contains 9 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 22-24 | 3 | |
| α-helix | 26 | 1 | |
| α-helix | 29-34 | 6 | |
| α-helix | 36-38 | 3 | |
| α-helix | 40-45 | 6 | |
| β-strand | 48-53 | 6 | 1 |
| β-strand | 57-60 | 4 | 2 |
| α-helix | 61-63 | 3 | |
| β-strand | 65-68 | 4 | 2 |
| β-strand | 71 | 1 | 3 |
| β-strand | 75-80 | 6 | 1 |
| β-strand | 84 | 1 | 4 |
| β-strand | 88-94 | 7 | 2 |
| α-helix | 97-99 | 3 | |
| β-strand | 105-109 | 5 | 1 |
| β-strand | 116-117 | 2 | 1 |
| β-strand | 130-134 | 5 | 1 |
| β-strand | 139 | 1 | 5 |
| β-strand | 140-141 | 2 | 1 |
| α-helix | 149-150 | 2 | |
| β-strand | 151 | 1 | 5 |
| α-helix | 161-163 | 3 | |
| β-strand | 166-172 | 7 | 2 |
| β-strand | 177-182 | 6 | 2 |
| β-strand | 185-191 | 7 | 2 |
| β-strand | 199 | 1 | 4 |
| β-strand | 200-205 | 6 | 1 |
| β-strand | 211-219 | 9 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7 | 1 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SPRY domain-containing SOCS box protein 2 | A | protein | 209 | Homo sapiens | Q99619 (AlphaFold model) |
| Nitric oxide synthase, inducible | B | protein | 9 | Homo sapiens | P35228 (AlphaFold model) |
>6KEY_1 SPRY domain-containing SOCS box protein 2 (chains A) MGDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRPVAQSTDGAR GKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHYAALLGSNSESWGWDIGRGK LYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGGTYLGPAFRGLKGRTL YPAVSAVWGQCQVRIRYLGERGSHHHHHH
>6KEY_2 Nitric oxide synthase, inducible (chains B) KDINNNVEK
Structural basis for the regulation of inducible nitric oxide synthase by the SPRY domain-containing SOCS box protein SPSB2, an E3 ubiquitin ligase. Li, K., You, T., Zhao, P. et al. Nitric Oxide (2021) 113-114:1-6. DOI 10.1016/j.niox.2021.04.004 · PubMed
Other PDB entries of the same protein (UniProt Q99619 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6KEY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.