3EMW: SPRY domain-containing SOCS box protein 2

Crystal Structure of human splA/ryanodine receptor domain and SOCS box containing 2 (SPSB2) in complex with a 20-residue VASA peptide. Determined by X-ray diffraction at 1.8 Å resolution. Released 28 Oct 2008.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,737
Mol. weight: 26.6 kDa
Released: 28 Oct 2008

Explore 3EMW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EMW contains 9 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	21-24	4
α-helix	25-26	2
α-helix	29-34	6
α-helix	36-38	3
α-helix	40-45	6
β-strand	48-53	6	1
β-strand	57-60	4	2
α-helix	61-63	3
β-strand	65-68	4	2
β-strand	71	1	3
β-strand	75-80	6	1
β-strand	84	1	4
β-strand	88-94	7	2
α-helix	97-99	3
β-strand	105-109	5	1
β-strand	116-117	2	1
β-strand	130-134	5	1
β-strand	139	1	5
β-strand	140-141	2	1
α-helix	149-150	2
β-strand	151	1	5
α-helix	159-163	5
β-strand	166-172	7	2
β-strand	177-182	6	2
β-strand	185-191	7	2
β-strand	199	1	4
β-strand	200-205	6	1
β-strand	211-218	8	2

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	189	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SPRY domain-containing SOCS box protein 2	A	protein	217	Homo sapiens	Q99619 (AlphaFold model)
Peptide (VASA)	B	protein	20		P09052 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3EMW_1 SPRY domain-containing SOCS box protein 2 (chains A)
MHHHHHHSSGVDLGTENLYFQSMPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEG
GLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHYAA
LLGSNSESWGWDIGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAI
GGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRIRYLGE

Sequence of entity 2 (B), FASTA

>3EMW_2 Peptide (VASA) (chains B)
DINNNNNIVEDVERKREFYI

Primary citation

Structural basis for Par-4 recognition by the SPRY domain- and SOCS box-containing proteins SPSB1, SPSB2, and SPSB4. Filippakopoulos, P., Low, A., Sharpe, T.D. et al. J Mol Biol (2010) 401:389-402. DOI 10.1016/j.jmb.2010.06.017 · PubMed

Other PDB entries of the same protein (UniProt Q99619 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JWM 1.23 Å, Crystal structure of the SPRY domain of SPSB2 in complex with cR7, a potent cyclic…
6KEY 1.24 Å, Structural basis for the regulation of inducible nitric oxide synthase (iNOS) by the…
5XN3 1.34 Å, Crystal structure of SPSB2 in complex with a rational designed RGD containing cyclic…
6DN6 1.59 Å, SPRY domain-containing SOCS box protein 2 complexed with INNN(ABU) cyclic peptide…
6JWN 1.61 Å, Crystal structure of the SPRY domain of SPSB2 in complex with cR9, a cyclic peptide…
9RV5 1.75 Å, Crystal structure of SPSB2 SPRY domain in complex with linear TAT peptide
6JKJ 1.9 Å, Crystal structure of human SPSB2 in the apo-state
6DN5 2.4 Å, SPRY domain-containing SOCS box protein 2 complexed with WDINNN(BAL) cyclic peptide…

Browse structure collections

About this viewer

MolViewer shows 3EMW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.