6KI6: BCL11A

Crystal structure of BCL11A in complex with gamma-globin -115 HPFH region. Determined by X-ray diffraction at 2.5 Å resolution. Released 11 Sept 2019.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 6
Atoms: 2,179
Mol. weight: 41.5 kDa
Ligands: ZN
Released: 11 Sept 2019

Explore 6KI6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KI6 contains 6 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	742-743	2	1
β-strand	750-751	2	1
α-helix	754-765	12
β-strand	770-771	2	2
β-strand	778-779	2	2
α-helix	782-789	8
α-helix	790-792	3
β-strand	800-801	2	3
β-strand	808-809	2	3
α-helix	812-822	11

Chain B: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	743	1	4
β-strand	750	1	4
α-helix	754-765	12
β-strand	771	1	5
β-strand	778	1	5
α-helix	782-787	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
B-cell lymphoma/leukemia 11A	A, B	protein	109	Homo sapiens	Q9H165 (AlphaFold model)
DNA (5'-d(aptpaptptpgpgptpcpapapgp*g)-3')	C, F	DNA	13	Homo sapiens
DNA (5'-d(tpcpcptptpgpapcpcpapaptp*a)-3')	D, E	DNA	13	Homo sapiens

Sequence of entity 1 (A, B), FASTA

>6KI6_1 B-cell lymphoma/leukemia 11A (chains A, B)
GSHMGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLT
RHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE

Sequence of entity 2 (C, F), FASTA

>6KI6_2 DNA (5'-D(*AP*TP*AP*TP*TP*GP*GP*TP*CP*AP*AP*GP*G)-3') (chains C, F)
ATATTGGTCAAGG

Sequence of entity 3 (D, E), FASTA

>6KI6_3 DNA (5'-D(*TP*CP*CP*TP*TP*GP*AP*CP*CP*AP*AP*TP*A)-3') (chains D, E)
TCCTTGACCAATA

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	5

Primary citation

Structural insights into the recognition of gamma-globin gene promoter by BCL11A. Yang, Y., Xu, Z., He, C. et al. Cell Res (2019) 29:960-963. DOI 10.1038/s41422-019-0221-0 · PubMed

Other PDB entries of the same protein (UniProt Q9H165 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6U9Q 1.83 Å, Crystal Structure Analysis of DNA-BCL11A Znf domain complex
9YLM 1.91 Å, BCL11A ZF4-6 in Complex with a DNA Sequence Observed in the Human Globin Locus…
9YLO 1.97 Å, BCL11A ZF2-3 in Complex with a DNA Sequence Observed in the Human Globin Locus…
9YLP 2.04 Å, BCL11A ZF2-3 in Complex with a DNA Sequence Observed in the Human Globin Locus…
9E6R 2.09 Å, BCL11A ZF4-6 in Complex with a DNA Sequence Observed in the Human Globin Locus…
9YLN 2.15 Å, BCL11A ZF4-6 in Complex with a DNA Sequence Observed in the Human Globin Locus…
8DTN 2.2 Å, The complex of nanobody 6101 with BCL11A ZF6
9E6S 2.2 Å, BCL11A ZF4-6 with K784T Mutation in Complex with a DNA Sequence Observed in the Human…
9YLL 2.38 Å, BCL11A ZF4-6 in Complex with a DNA Sequence Observed in the Human Globin Locus…
5VTB 2.4 Å, Crystal structure of RBBP4 bound to BCL11a peptide
8DTU 2.45 Å, The complex of nanobody 5344N74D with BCL11A ZF6.
9B4P 2.56 Å, Tetramer Formation of the BCL11A ZF0 Domain

Browse structure collections

About this viewer

MolViewer shows 6KI6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.