6KP6: PDB entry 6KP6

The structural study of mutation induced inactivation of Human muscarinic receptor M4. Determined by X-ray diffraction at 3.0 Å resolution. Released 11 Mar 2020.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: Homo sapiens, Pyrococcus abyssi GE5
Chains: 1
Atoms: 3,711
Mol. weight: 55.44 kDa
Released: 11 Mar 2020

Explore 6KP6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KP6 contains 25 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	30-59	30
α-helix	61-63	3
α-helix	66-80	15
α-helix	81-85	5
α-helix	86-95	10
α-helix	101-135	35
α-helix	140-143	4
α-helix	146-175	30
α-helix	188-191	4
α-helix	193-200	8
α-helix	201-205	5
α-helix	206-223	18
α-helix	1009-1011	3
α-helix	1016-1026	11
β-strand	1033-1038	6	1
β-strand	1041	1	2
α-helix	1048-1058	11
α-helix	1064-1066	3
β-strand	1067-1072	6	1
β-strand	1075	1	2
α-helix	1077-1089	13
β-strand	1093-1096	4	1
α-helix	1102-1109	8
β-strand	1114-1117	4	1
α-helix	1126-1133	8
α-helix	1136	1
β-strand	1137-1141	5	1
α-helix	1144-1149	6
β-strand	1156-1158	3	1
α-helix	1163-1175	13
α-helix	1180-425	53
α-helix	432-456	25
α-helix	458-469	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Muscarinic acetylcholine receptor M4,GlgA glycogen synthase,Muscarinic acetylcholine receptor M4	A	protein	492	Homo sapiens, Pyrococcus abyssi GE5	P08173 (AlphaFold model), Q9V2J8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6KP6_1 Muscarinic acetylcholine receptor M4,GlgA glycogen synthase,Muscarinic acetylcholine receptor M4 (chains A)
SSHNRYETVEMVFIATVTGSLSLVTVVGNILVMLSIKVNRQLQTVNNYFLFSLACADLII
GAFSMNLYTVYTIKGYWPLGAVVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYP
ARRTTKMAALMIAAAWVLSFVLWAPAILFWQFVVGKRTVPDNQCFAQFLSNPAVTFGTAI
AAFYLPVVIMTVLYIHIYLASRSRVHGIDCSFWNESYLTGSRDERKKSLLSKFGMDEGVT
FMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELEGWARSLEEKHGNVK
VITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRDIITNET
GILVKAGDPGELANAILKALELSRSDLSKFRENCKKRAMSFSQMAARERKVTRTIFAILL
AFILTWTPYNVMVLVNTFCQSCIPDTVWSIGYWLCYVNSTIRPACYALCNAEFKKTFRHL
LLCQYRNIGTAR

Primary citation

The structural study of mutation-induced inactivation of human muscarinic receptor M4. Wang, J.J., Wu, M., Wu, L.J. et al. IUCrJ (2020) 7:294-305. DOI 10.1107/S2052252520000597

Other PDB entries of the same protein (UniProt P08173 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7TRP 2.4 Å, Human M4 muscarinic acetylcholine receptor complex with Gi1 and the agonist iperoxo and…
8FX5 2.45 Å, Human M4 muscarinic acetylcholine receptor complex with Gi1 and xanomeline
7TRQ 2.5 Å, Human M4 muscarinic acetylcholine receptor complex with Gi1 and the agonist iperoxo and…
9N09 2.57 Å, Human M4 muscarinic acetylcholine receptor Gi1 complex (mini-Gsi chimera) bound to the…
5DSG 2.6 Å, Structure of the M4 muscarinic acetylcholine receptor (M4-mT4L) bound to tiotropium
9N29 2.6 Å, hM4Di(GRANPA) in complex with mGsI and diphenhydramine
8E9X 2.7 Å, CryoEM structure of miniGo-coupled hM4Di in complex with DCZ
9KVP 2.79 Å, Structure of SB290157 bound to human C3aR in complex with Go (Full map)
7TRK 2.8 Å, Human M4 muscarinic acetylcholine receptor complex with Gi1 and the agonist iperoxo
7TRS 2.8 Å, Human M4 muscarinic acetylcholine receptor complex with Gi1 and the endogenous agonist…
9KVS 2.81 Å, Structure of SB290157 bound to human C3aR in complex with Go (Receptor Ligand Focused map)
9KV6 2.88 Å, Structure of mouse TLQP21 bound to mouse C3aR in complex with Go

Browse structure collections

About this viewer

MolViewer shows 6KP6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.