6KRU: Mouse IgG2b Fc

Crystal structure of mouse IgG2b Fc. Determined by X-ray diffraction at 2.3 Å resolution. Released 22 Jan 2020.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Mus musculus
Chains: 6
Atoms: 10,678
Mol. weight: 156.79 kDa
Released: 22 Jan 2020

Explore 6KRU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KRU contains 52 α-helices and 114 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	239-243	5	1
α-helix	244-246	3
α-helix	247-251	5
β-strand	258-266	9	1
β-strand	274-279	6	2
β-strand	282-284	3	2
β-strand	288-294	7	1
β-strand	299-307	9	1
α-helix	310-314	5
β-strand	319-324	6	2
α-helix	331	1
β-strand	332-336	5	2
β-strand	344	1	3
α-helix	345-346	2
β-strand	347-351	5	4
α-helix	352-354	3
α-helix	355-357	3
β-strand	362-372	11	4
β-strand	373	1	3
β-strand	378-383	6	5
β-strand	386-387	2	5
β-strand	391-393	3	4
β-strand	397-398	2	4
β-strand	404-413	10	4
α-helix	414-419	6
β-strand	423-428	6	5
α-helix	433-435	3
β-strand	437-441	5	5

Chain B: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	239-243	5	6
α-helix	244-246	3
α-helix	247-251	5
β-strand	258-266	9	6
β-strand	274-279	6	7
β-strand	282-284	3	7
β-strand	288-294	7	6
β-strand	299-307	9	6
α-helix	310-314	5
β-strand	319-324	6	7
β-strand	332-336	5	7
β-strand	344	1	8
α-helix	345-346	2
β-strand	347-351	5	9
α-helix	352-354	3
α-helix	355-357	3
β-strand	362-372	11	9
β-strand	373	1	8
β-strand	378-383	6	10
β-strand	386-388	3	10
β-strand	391-393	3	9
α-helix	394-396	3
β-strand	397-398	2	9
β-strand	404-413	10	9
α-helix	414-419	6
β-strand	423-428	6	10
α-helix	433-435	3
β-strand	437-441	5	10

Chain C: 8 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	239-243	5	11
α-helix	247-250	4
β-strand	258-266	9	11
β-strand	274-279	6	12
β-strand	282-284	3	12
β-strand	288-294	7	11
β-strand	299-307	9	11
α-helix	310-315	6
β-strand	319-324	6	12
β-strand	332-336	5	12
β-strand	344	1	13
α-helix	345-346	2
β-strand	347-351	5	14
α-helix	352-354	3
α-helix	355-357	3
β-strand	362-372	11	14
β-strand	373	1	13
β-strand	378-383	6	15
β-strand	386-388	3	15
β-strand	391-393	3	14
α-helix	394-396	3
β-strand	397-398	2	14
β-strand	404-413	10	14
α-helix	414-419	6
β-strand	423-428	6	15
α-helix	433-435	3
β-strand	437-441	5	15

Chain D: 10 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	239-243	5	16
α-helix	244-246	3
α-helix	247-251	5
β-strand	258-264	7	16
β-strand	274-279	6	17
β-strand	282-284	3	17
β-strand	288-294	7	16
β-strand	299-307	9	16
α-helix	310-314	5
α-helix	317-318	2
β-strand	319-324	6	17
α-helix	330-331	2
β-strand	332-336	5	17
β-strand	344	1	18
α-helix	345-346	2
β-strand	347-351	5	19
α-helix	352-354	3
α-helix	355-357	3
β-strand	362-372	11	19
β-strand	373	1	18
β-strand	378-383	6	20
β-strand	386-388	3	20
β-strand	391-393	3	19
β-strand	397-398	2	19
β-strand	404-413	10	19
α-helix	414-419	6
β-strand	423-428	6	20
α-helix	433-435	3
β-strand	437-441	5	20

Chain E: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	239-243	5	21
α-helix	244-246	3
α-helix	247-251	5
β-strand	258-264	7	21
β-strand	275-279	5	22
β-strand	282-284	3	22
β-strand	288-291	4	21
β-strand	302-307	6	21
α-helix	310-314	5
β-strand	319-323	5	22
α-helix	330-331	2
β-strand	332-336	5	22
β-strand	344	1	23
α-helix	345-346	2
β-strand	347-351	5	24
α-helix	352-354	3
α-helix	355-357	3
β-strand	362-372	11	24
β-strand	373	1	23
β-strand	378-383	6	25
β-strand	386-388	3	25
β-strand	391-393	3	24
β-strand	397-398	2	24
β-strand	404-413	10	24
α-helix	414-419	6
β-strand	423-428	6	25
α-helix	433-435	3
β-strand	437-441	5	25

Chain F: 7 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	239-243	5	26
α-helix	244-246	3
α-helix	247-251	5
β-strand	258-264	7	26
β-strand	274-279	6	27
β-strand	282-284	3	27
β-strand	288-294	7	26
β-strand	299-307	9	26
α-helix	310-314	5
β-strand	319-324	6	27
β-strand	332-336	5	27
β-strand	344	1	28
α-helix	345-346	2
β-strand	347-351	5	29
α-helix	355-359	5
β-strand	362-372	11	29
β-strand	373	1	28
β-strand	378-383	6	30
β-strand	386-388	3	30
β-strand	391-393	3	29
β-strand	397-398	2	29
β-strand	404-413	10	29
α-helix	414-419	6
β-strand	423-428	6	30
α-helix	433-435	3
β-strand	437-441	5	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ig gamma-2B chain C region	A, B, C, D, E, F	protein	218	Mus musculus	P01867 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>6KRU_1 Ig gamma-2B chain C region (chains A, B, C, D, E, F)
CPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQ
TQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQV
YILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYS
KLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPG

Primary citation

On-Membrane Dynamic Interplay between Anti-GM1 IgG Antibodies and Complement Component C1q. Yanaka, S., Yogo, R., Watanabe, H. et al. Int J Mol Sci (2019) 21. DOI 10.3390/ijms21010147 · PubMed

Other PDB entries of the same protein (UniProt P01867 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1YNL 1.7 Å, Identification of Key residues of the NC6.8 Fab antibody fragment binding to synthetic…
1OSP 1.95 Å, Crystal structure of outer surface protein A of borrelia burgdorferi complexed with a…
1NBV 2.0 Å, An autoantibody to single-stranded DNA: comparison of the three-dimensional structures…
1UB5 2.0 Å, Crystal structure of Antibody 19G2 with hapten at 100K
1YNK 2.1 Å, Identification of Key residues of the NC6.8 Fab antibody fragment binding to synthetic…
1UB6 2.12 Å, Crystal structure of Antibody 19G2 with sera ligand
2RGS 2.13 Å, FC-fragment of monoclonal antibody IGG2B from Mus musculus
2Q8B 2.3 Å, Structure of the malaria antigen AMA1 in complex with a growth-inhibitory antibody
2Q8A 2.4 Å, Structure of the malaria antigen AMA1 in complex with a growth-inhibitory antibody
1FL3 2.45 Å, Crystal structure of the blue fluorescent antibody (19G2) in complex with stilbene…
1MAM 2.45 Å, Crystal structure to 2.45 a resolution of a monoclonal FAB specific for the brucella a…
2GK0 2.45 Å, Structure of Catalytic Elimination Antibody 13G5 from a twinned crystal in space group C2

Browse structure collections

About this viewer

MolViewer shows 6KRU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.