6KT1: OspA mutant

Crystal structure of an OspA mutant. Determined by X-ray diffraction at 1.43 Å resolution. Released 26 Aug 2020.

Method: X-ray diffraction
Resolution: 1.43 Å
Organism: Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Chains: 1
Atoms: 2,208
Mol. weight: 25.88 kDa
Released: 26 Aug 2020

Explore 6KT1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KT1 contains 2 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain O: 2 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	30-34	5	1
β-strand	38-42	5	1
β-strand	52-58	7	1
β-strand	61-67	7	1
β-strand	74-79	6	1
β-strand	85-90	6	1
β-strand	97-102	6	1
β-strand	109-115	7	1
β-strand	121-126	6	1
β-strand	132-138	7	1
β-strand	144-148	5	1
β-strand	156-162	7	1
β-strand	165-171	7	1
β-strand	175-182	8	1
β-strand	185-192	8	1
β-strand	197-203	7	1
β-strand	212-217	6	2
β-strand	222-227	6	2
β-strand	230-237	8	2
β-strand	243-247	5	2
β-strand	248	1	3
α-helix	249	1
β-strand	255	1	3
β-strand	260-261	2	2
α-helix	265-271	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer surface protein A	O	protein	246	Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)	P0CL66 (AlphaFold model)

Sequence of entity 1 (O), FASTA

>6KT1_1 Outer surface protein A (chains O)
NSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVK
LTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKSVTFEKFNEKGEVSEKIITRADGTRLEY
TGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGAVSVELNDTDSS
AATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDE
IKNALK

Primary citation

Crystal structure of an OspA mutant. Namioka, S., Makabe, K. To be published.

Other PDB entries of the same protein (UniProt P0CL66 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2I5V 1.1 Å, Crystal structure of OspA mutant
2G8C 1.15 Å, Atomic-resolution crystal structure of Borrelia burgdorferi OspA via surface entropy…
2I5Z 1.2 Å, The crystal structure of OspA mutant
6J48 1.2 Å, Glycine mutation on single layer beta-sheet of OspAsm1
9WVV 1.27 Å, The crystal structure of OspA mutant
2OYB 1.3 Å, The crystal structure of OspA mutant
2OL7 1.35 Å, The crystal structure of OspA mutant
6KWV 1.37 Å, A Crystal Structure of OspA mutant
2PI3 1.4 Å, The crystal structure of OspA mutant
6ICS 1.4 Å, Loop deletion mutant (deleting four residues)
6KWU 1.43 Å, A Crystal Structure of OspA mutant
6J6E 1.5 Å, Borrelia burgdorferi OspA via surface entropy reduction (form5)

Browse structure collections

About this viewer

MolViewer shows 6KT1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.