6KU0: MyoVa-GTD

Crystal structure of MyoVa-GTD in complex with MICAL1-GTBM. Determined by X-ray diffraction at 1.6 Å resolution. Released 2 Sept 2020.

Method: X-ray diffraction
Resolution: 1.6 Å
Organisms: Mus musculus, Homo sapiens
Chains: 4
Atoms: 7,043
Mol. weight: 95.2 kDa
Released: 2 Sept 2020

Explore 6KU0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KU0 contains 54 α-helices and 10 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	1475-1476	2	1
α-helix	1479-1481	3
α-helix	1482-1486	5
α-helix	1487-1491	5
α-helix	1498-1502	5
α-helix	1506-1520	15
α-helix	1524-1545	22
α-helix	1549-1568	20
α-helix	1573-1575	3
α-helix	1581-1585	5
β-strand	1591-1592	2	2
α-helix	1594-1624	31
α-helix	1625-1629	5
β-strand	1633	1	3
β-strand	1636	1	3
α-helix	1637-1638	2
α-helix	1659-1675	17
α-helix	1680-1704	25
α-helix	1711-1730	20
α-helix	1734-1736	3
α-helix	1739-1742	4
α-helix	1743-1751	9
α-helix	1759-1768	10
α-helix	1774-1783	10
α-helix	1784-1786	3
α-helix	1792-1795	4
α-helix	1796-1805	10
α-helix	1823-1825	3
α-helix	1836-1838	3
α-helix	1843-1845	3
β-strand	1851-1852	2	1

Chains B and D: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	804-805	2	2
α-helix	806-809	4
α-helix	810-817	8

Chain C: 24 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	1475-1476	2	4
α-helix	1479-1481	3
α-helix	1482-1486	5
α-helix	1487-1491	5
α-helix	1495-1501	7
α-helix	1506-1520	15
α-helix	1524-1545	22
α-helix	1549-1568	20
α-helix	1573-1575	3
α-helix	1581-1585	5
β-strand	1591-1592	2	5
α-helix	1594-1624	31
α-helix	1625-1629	5
α-helix	1659-1675	17
α-helix	1680-1704	25
α-helix	1711-1730	20
α-helix	1734-1736	3
α-helix	1739-1742	4
α-helix	1743-1753	11
α-helix	1759-1768	10
α-helix	1774-1783	10
α-helix	1792-1795	4
α-helix	1796-1805	10
α-helix	1823-1825	3
α-helix	1836-1838	3
α-helix	1843-1845	3
β-strand	1851-1852	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Unconventional myosin-Va	A, C	protein	389	Mus musculus	Q99104 (AlphaFold model)
Peptide from [F-actin]-monooxygenase MICAL1	B, D	protein	27	Homo sapiens	Q8TDZ2 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>6KU0_1 Unconventional myosin-Va (chains A, C)
GPGSKDFQGMLEYKREDEQKLVKNLILELKPRGVAVNLIPGLPAYILFMCVRHADYLNDD
QKVRSLLTSTINSIKKVLKKRGDDFETVSFWLSNTCRFLHCLKQYSGEEGFMKHNTSRQN
EHCLTNFDLAEYRQVLSDLAIQIYQQLVRVLENILQPMIVSGMLEHETIQGVSGVKPTGL
RKRTSSIADEGTYTLDSILRQLNSFHSVMCQHGMDPELIKQVVKQMFYIVGAITLNNLLL
RKDMCSWSKGMQIRYNVSQLEEWLRDKNLMNSGAKETLEPLIQAAQLLQVKKKTDDDAEA
ICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLRDRKDSPQLLMDAKHIFP
VTFPFNPSSLALETIQIPASLGLGFIARV

Sequence of entity 2 (B, D), FASTA

>6KU0_2 Peptide from [F-actin]-monooxygenase MICAL1 (chains B, D)
GPGSQPTRRQIRLSSPERQRLSSLNLT

Primary citation

F-actin disassembly factor MICAL1 binding to Myosin Va mediates cargo unloading during cytokinesis. Niu, F., Sun, K., Wei, W. et al. Sci Adv (2020) 6. DOI 10.1126/sciadv.abb1307 · PubMed

Other PDB entries of the same protein (UniProt Q99104 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4KP3 2.4 Å, Crystal Structure of MyoVa-GTD in Complex with Two Cargos
3WB8 2.5 Å, Crystal Structure of MyoVa-GTD
2IX7 2.5 Å, Structure of apo-calmodulin bound to unconventional myosin V
4ZLK 2.5 Å, Crystal structure of mouse myosin-5a in complex with calcium-bound calmodulin
8RBF 4.2 Å, CryoEM structure of the post-powerstroke actomyosin-5a complex
8R9V 4.4 Å, CryoEM structure of the primed actomyosin-5a complex
7YV9 4.78 Å, Cryo-EM structure of full-length Myosin Va in the autoinhibited state
8RBG 4.9 Å, CryoEM structure of primed myosin-5a (ADP-Pi state)
8OF8 7.5 Å, Cryo-EM structure of actomyosin-5a-S1 with the full-length lever (nucleotide free)

Browse structure collections

About this viewer

MolViewer shows 6KU0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.