6KWV: A Crystal Structure of OspA mutant

A Crystal Structure of OspA mutant. Determined by X-ray diffraction at 1.37 Å resolution. Released 9 Sept 2020.

Method: X-ray diffraction
Resolution: 1.37 Å
Organism: Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Chains: 1
Atoms: 2,184
Mol. weight: 25.88 kDa
Released: 9 Sept 2020

Explore 6KWV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KWV contains 3 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain O: 3 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	1
α-helix	35-37	3
β-strand	39-43	5	1
α-helix	51	1
β-strand	52-58	7	1
β-strand	61-67	7	1
β-strand	74-79	6	1
β-strand	85-90	6	1
β-strand	96-102	7	1
β-strand	109-116	8	1
β-strand	119-126	8	1
β-strand	129-135	7	1
β-strand	141-147	7	1
β-strand	153-159	7	1
β-strand	162-168	7	1
β-strand	172-179	8	1
β-strand	182-189	8	1
β-strand	194-200	7	1
β-strand	209-214	6	2
β-strand	219-224	6	2
β-strand	227-234	8	2
β-strand	240-244	5	2
β-strand	245	1	3
β-strand	252	1	3
β-strand	257-258	2	2
α-helix	262-269	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer surface protein A	O	protein	248	Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)	P0CL66 (AlphaFold model)

Sequence of entity 1 (O), FASTA

>6KWV_1 Outer surface protein A (chains O)
GSHMKNSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKAD
ASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSNGSSTEEKSSNGSSEKIITRADGTRL
EYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTD
SSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKL
DEIKNALK

Primary citation

beta-Strand-mediated Domain-swapping in the Absence of Hydrophobic Core Repacking. Kiya, M., Shiga, S., Ding, P. et al. J Mol Biol (2024) 436:168405-168405. DOI 10.1016/j.jmb.2023.168405 · PubMed

Other PDB entries of the same protein (UniProt P0CL66 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2I5V 1.1 Å, Crystal structure of OspA mutant
2G8C 1.15 Å, Atomic-resolution crystal structure of Borrelia burgdorferi OspA via surface entropy…
2I5Z 1.2 Å, The crystal structure of OspA mutant
6J48 1.2 Å, Glycine mutation on single layer beta-sheet of OspAsm1
9WVV 1.27 Å, The crystal structure of OspA mutant
2OYB 1.3 Å, The crystal structure of OspA mutant
2OL7 1.35 Å, The crystal structure of OspA mutant
2PI3 1.4 Å, The crystal structure of OspA mutant
6ICS 1.4 Å, Loop deletion mutant (deleting four residues)
6KT1 1.43 Å, Crystal structure of an OspA mutant
6KWU 1.43 Å, A Crystal Structure of OspA mutant
6J6E 1.5 Å, Borrelia burgdorferi OspA via surface entropy reduction (form5)

Browse structure collections

About this viewer

MolViewer shows 6KWV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.