6KZ1: Complex structure of Whirlin and Myosin XVa

Complex structure of Whirlin and Myosin XVa. Determined by X-ray diffraction at 1.69 Å resolution. Released 23 Sept 2020.

Method: X-ray diffraction
Resolution: 1.69 Å
Organism: Homo sapiens
Chains: 2
Atoms: 864
Mol. weight: 14.04 kDa
Released: 23 Sept 2020

Explore 6KZ1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KZ1 contains 3 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	814-820	7	1
β-strand	828-831	4	1
β-strand	842-846	5	1
α-helix	851-855	5
β-strand	863-867	5	1
β-strand	870-871	2	1
α-helix	877-889	13
β-strand	895-901	7	1

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	3503-3506	4
β-strand	3508-3510	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Whirlin	A	protein	113	Homo sapiens	Q9P202 (AlphaFold model)
Myosin XVa	B	protein	14	Homo sapiens	Q9UKN7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6KZ1_1 Whirlin (chains A)
MHHHHHHSSGLEVLFQGPGSTLVRVKKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHN
CGQLKVGHVILEVNGLTLRGKEHREAARIIAEAFKTKDRDYIDFLVTEFNVML

Sequence of entity 2 (B), FASTA

>6KZ1_2 Myosin XVa (chains B)
EKRLTLPPSEITLL

Primary citation

Phase separation-mediated condensation of Whirlin-Myo15-Eps8 stereocilia tip complex. Lin, L., Shi, Y., Wang, M. et al. Cell Rep (2021) 34:108770-108770. DOI 10.1016/j.celrep.2021.108770 · PubMed

Other PDB entries of the same protein (UniProt Q9P202 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7EP7 2.6 Å, The complex structure of Gpsm2 and Whirlin
1UEZ Solution structure of the first PDZ domain of human KIAA1526 protein
1UF1 Solution structure of the second PDZ domain of human KIAA1526 protein
1UFX Solution structure of the third PDZ domain of human KIAA1526 protein

Browse structure collections

About this viewer

MolViewer shows 6KZ1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.