6KZ7: SWI/SNF complex subunit SMARCC1

The crystal structure of BAF155 SWIRM domain and N-terminal elongated hSNF5 RPT1 domain complex: Chromatin remodeling complex. Determined by X-ray diffraction at 2.28 Å resolution. Released 8 Jul 2020.

Method: X-ray diffraction
Resolution: 2.28 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,099
Mol. weight: 41.06 kDa
Released: 8 Jul 2020

Explore 6KZ7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KZ7 contains 22 α-helices and 7 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	453-455	3
β-strand	462	1	1
α-helix	465-470	6
α-helix	472-474	3
α-helix	484-500	17
α-helix	508-512	5
β-strand	518	1	2
α-helix	519-531	13

Chain B: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	172-180	9
α-helix	183-184	2
β-strand	186-195	10	2
β-strand	198-207	10	2
α-helix	215-226	12
α-helix	230-247	18
α-helix	248-250	3

Chain C: 7 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	453-455	3
β-strand	462	1	1
α-helix	465-470	6
α-helix	472-474	3
α-helix	484-500	17
α-helix	508-512	5
α-helix	519-531	13
α-helix	539-541	3

Chain D: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	173-180	8
α-helix	183-184	2
β-strand	186-195	10	3
β-strand	198-207	10	3
α-helix	215-226	12
α-helix	230-247	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SWI/SNF complex subunit SMARCC1	A, C	protein	95	Homo sapiens	Q92922 (AlphaFold model)
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1	B, D	protein	82	Homo sapiens	Q12824 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>6KZ7_1 SWI/SNF complex subunit SMARCC1 (chains A, C)
GIIIPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLT
STACRRNLTGDVCAVMRVHAFLEQWGLVNYQVDPE

Sequence of entity 2 (B, D), FASTA

>6KZ7_2 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (chains B, D)
HDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNP
LTFVPAIASAIRQQIESYPTDS

Primary citation

A Coil-to-Helix Transition Serves as a Binding Motif for hSNF5 and BAF155 Interaction. Han, J., Kim, I., Park, J.H. et al. Int J Mol Sci (2020) 21. DOI 10.3390/ijms21072452 · PubMed

Other PDB entries of the same protein (UniProt Q92922 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YXP 1.6 Å, Higher resolution structure of the N-terminal module of the human SWI/SNF-subunit…
6YXO 2.0 Å, Structure of the N-terminal module of the human SWI/SNF-subunit BAF155/SMARCC1
5GJK 2.05 Å, Crystal Structure of BAF47 and BAF155 Complex
2YUS Solution structure of the SANT domain of human SWI/SNF-related matrix-associated…
9A0K A structural model of the endogenoushuman SWI/SNF (BAF) complex bound to the nucleosome…

Browse structure collections

About this viewer

MolViewer shows 6KZ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.