6L9K: H2-Ld a1a2

H2-Ld a1a2 complexed with A5 peptide. Determined by X-ray diffraction at 1.8 Å resolution. Released 18 Nov 2020.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,753
Mol. weight: 21.66 kDa
Released: 18 Nov 2020

Explore 6L9K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6L9K contains 7 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	3-13	11	1
α-helix	20	1
β-strand	21-28	8	1
β-strand	31-37	7	1
β-strand	46-47	2	1
α-helix	50-54	5
α-helix	57-84	28
α-helix	87-88	2
β-strand	93-103	11	1
β-strand	109-118	10	1
β-strand	121-126	6	1
β-strand	133-135	3	1
α-helix	138-150	13
α-helix	152-161	10
α-helix	163-174	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
H2-Ld a1a2	A	protein	175	Homo sapiens	P01897 (AlphaFold model)
Ser-pro-ser-tyr-ala-tyr-his-gln-phe	Q	protein	9	Homo sapiens

Sequence of entity 1 (A), FASTA

>6L9K_1 H2-Ld a1a2 (chains A)
GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYW
ERITQIAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDG
CDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG

Sequence of entity 2 (Q), FASTA

>6L9K_2 SER-PRO-SER-TYR-ALA-TYR-HIS-GLN-PHE (chains Q)
SPSYAYHQF

Primary citation

Structures suggest an approach for converting weak self-peptide tumor antigens into superagonists for CD8 T cells in cancer. Wei, P., Jordan, K.R., Buhrman, J.D. et al. Proc Natl Acad Sci U S A (2021) 118. DOI 10.1073/pnas.2100588118 · PubMed

Other PDB entries of the same protein (UniProt P01897 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3V4U 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
3UO1 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
3V52 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
3UYR 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
8D5N 1.8 Å, Crystal structure of Ld-HF10
3VJ6 1.9 Å, Structure of the MHC class Ib molecule Qa-1b
4MS8 1.92 Å, 42F3 TCR pCPB9/H-2Ld Complex
3ERY 1.95 Å, Different thermodynamic binding mechanisms and peptide fine specificities associated…
5VCL 2.05 Å, Structure of the Qdm peptide bound to Qa-1a
3TJH 2.12 Å, 42F3-p3A1/H2-Ld complex
2OI9 2.35 Å, Structure of the 2C/Ld/QL9 allogeneic complex
6L9L 2.4 Å, 1D4 TCR recognition of H2-Ld a1a2 A5 Peptide Complexes

Browse structure collections

About this viewer

MolViewer shows 6L9K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.