6LEY: Sil1G bound FEM1C

Structure of Sil1G bound FEM1C. Determined by X-ray diffraction at 2.39 Å resolution. Released 21 Oct 2020.

Method: X-ray diffraction
Resolution: 2.39 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,752
Mol. weight: 91.23 kDa
Released: 21 Oct 2020

Explore 6LEY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6LEY contains 53 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	3-12	10
α-helix	16-25	10
α-helix	30-35	6
β-strand	39	1	1
β-strand	42	1	1
α-helix	44-50	7
α-helix	54-63	10
β-strand	72-76	5	2
β-strand	79-84	6	2
α-helix	86-93	8
α-helix	96-104	9
α-helix	119-125	7
α-helix	129-137	9
α-helix	152-158	7
α-helix	162-170	9
α-helix	185-192	8
α-helix	195-202	8
α-helix	206-208	3
α-helix	217-224	8
α-helix	227-233	7
α-helix	241-257	17
α-helix	262-276	15
α-helix	285-287	3
α-helix	294-296	3
α-helix	305-310	6
α-helix	311-313	3
α-helix	315-329	15
α-helix	335-350	16
α-helix	354-369	16
α-helix	386-389	4

Chain B: 27 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	6-12	7
α-helix	18-21	4
α-helix	31-35	5
α-helix	44-50	7
α-helix	54-62	9
α-helix	67-69	3
β-strand	72-76	5	3
β-strand	79-84	6	3
α-helix	86-92	7
α-helix	96-104	9
α-helix	119-125	7
α-helix	129-137	9
α-helix	152-158	7
α-helix	162-170	9
α-helix	185-192	8
α-helix	195-202	8
α-helix	206-208	3
α-helix	217-224	8
α-helix	227-233	7
α-helix	241-257	17
α-helix	262-277	16
α-helix	285-287	3
α-helix	294-296	3
α-helix	305-308	4
α-helix	311-313	3
α-helix	315-330	16
α-helix	335-350	16
α-helix	354-369	16
α-helix	386-389	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein fem-1 homolog C,Peptide from Nucleotide exchange factor SIL1	A, B	protein	419	Homo sapiens	Q96JP0 (AlphaFold model), Q9H173 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6LEY_1 Protein fem-1 homolog C,Peptide from Nucleotide exchange factor SIL1 (chains A, B)
GHMDLKTAVFNAARDGKLRLLTKLLASKSKEEVSSLISEKTNGATPLLMAARYGHLDMVE
FLLEQCSASIEVGGSVNFDGETIEGAPPLWAASAAGHLKVVQSLLNHGASVNNTTLTNST
PLRAACFDGHLEIVKYLVEHKADLEVSNRHGHTCLMISCYKGHKEIAQYLLEKGADVNRK
SVKGNTALHDCAESGSLDIMKMLLMYCAKMEKDGYGMTPLLSASVTGHTNIVDFLTHHAQ
TSKTERINALELLGATFVDKKRDLLGALKYWKKAMNMRYSDRTNIISKPVPQTLIMAYDY
AKEVNSAEELEGLIADPDEMRMQALLIRERILGPSHPDTSYYIRYRGAVYADSGNFKRCI
NLWKYALDMQQSNLDPLSPMTASSLLSFAELFGGGSGGGSGGGSGGGSSVNSLLKELRG

Primary citation

Molecular basis for arginine C-terminal degron recognition by Cul2 FEM1 E3 ligase. Chen, X., Liao, S., Makaros, Y. et al. Nat Chem Biol (2021) 17:254-262. DOI 10.1038/s41589-020-00704-3 · PubMed

Other PDB entries of the same protein (UniProt Q96JP0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6XKC 2.03 Å, Crystal structure of E3 ligase
6LF0 2.11 Å, Structure of FEM1C
6LE6 2.33 Å, Structure of LNLPTQGRAR bound FEM1C
6LDP 2.35 Å, Structure of CDK5R1-bound FEM1C
6LEN 2.38 Å, Structure of NS11 bound FEM1C
7JYA 2.46 Å, Crystal structure of E3 ligase in complex with peptide
6LBG 2.51 Å, Structure of OR51B2 bound FEM1C
6LBN 2.9 Å, Structure of SIL1-bound FEM1C
9UA3 3.28 Å, Cryo-EM structure of neddylated CUL2-RBX1-FEM1C-ELOB-ELOC
8Q7R 3.71 Å, Ubiquitin ligation to substrate by a cullin-RING E3 ligase & Cdc34:…
8PQL 3.76 Å, K48-linked ubiquitin chain formation with a cullin-RING E3 ligase and Cdc34:…

Browse structure collections

About this viewer

MolViewer shows 6LEY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.