6LJY: A Crystal Structure of OspA mutant

A Crystal Structure of OspA mutant. Determined by X-ray diffraction at 1.5 Å resolution. Released 23 Dec 2020.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Borreliella burgdorferi
Chains: 1
Atoms: 2,181
Mol. weight: 25.42 kDa
Released: 23 Dec 2020

Explore 6LJY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6LJY contains 3 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain O: 3 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	30-34	5	1
β-strand	38-42	5	1
α-helix	51	1
β-strand	52-58	7	1
β-strand	61-67	7	1
β-strand	74-79	6	1
β-strand	85-90	6	1
β-strand	96-102	7	1
β-strand	109-116	8	1
β-strand	119-124	6	1
β-strand	127-131	5	1
β-strand	137-141	5	1
β-strand	149-155	7	1
β-strand	158-164	7	1
β-strand	168-175	8	1
β-strand	178-185	8	1
β-strand	190-196	7	1
β-strand	205-210	6	2
β-strand	215-220	6	2
β-strand	223-230	8	2
β-strand	236-240	5	2
β-strand	241	1	3
α-helix	242	1
β-strand	248	1	3
β-strand	253-254	2	2
α-helix	258-265	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
OspA163	O	protein	244	Borreliella burgdorferi	P0CL66 (AlphaFold model)

Sequence of entity 1 (O), FASTA

>6LJY_1 OspA163 (chains O)
GSHMKNSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKAD
ASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSGGSSTEEKGGEKIITRADGTRLEYTG
IKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAA
TKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIK
NALK

Primary citation

beta-Strand-mediated Domain-swapping in the Absence of Hydrophobic Core Repacking. Kiya, M., Shiga, S., Ding, P. et al. J Mol Biol (2024) 436:168405-168405. DOI 10.1016/j.jmb.2023.168405 · PubMed

Other PDB entries of the same protein (UniProt P0CL66 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2I5V 1.1 Å, Crystal structure of OspA mutant
2G8C 1.15 Å, Atomic-resolution crystal structure of Borrelia burgdorferi OspA via surface entropy…
2I5Z 1.2 Å, The crystal structure of OspA mutant
6J48 1.2 Å, Glycine mutation on single layer beta-sheet of OspAsm1
9WVV 1.27 Å, The crystal structure of OspA mutant
2OYB 1.3 Å, The crystal structure of OspA mutant
2OL7 1.35 Å, The crystal structure of OspA mutant
6KWV 1.37 Å, A Crystal Structure of OspA mutant
2PI3 1.4 Å, The crystal structure of OspA mutant
6ICS 1.4 Å, Loop deletion mutant (deleting four residues)
6KT1 1.43 Å, Crystal structure of an OspA mutant
6KWU 1.43 Å, A Crystal Structure of OspA mutant

Browse structure collections

About this viewer

MolViewer shows 6LJY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.