6LO2: EED

Crystal structure of EED in complex with EZH2 peptide and compound 11#. Determined by X-ray diffraction at 2.21 Å resolution. Released 7 Jul 2021.

Method: X-ray diffraction
Resolution: 2.21 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,729
Mol. weight: 92.73 kDa
Ligands: EJU
Released: 7 Jul 2021

Explore 6LO2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6LO2 contains 13 α-helices and 62 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	82-89	8	1
α-helix	94-96	3
β-strand	98-101	4	2
α-helix	106	1
α-helix	110	1
β-strand	111-117	7	2
β-strand	120-126	7	2
β-strand	132-139	8	2
β-strand	147-154	8	3
β-strand	161-167	7	3
β-strand	172-175	4	3
β-strand	182-186	5	3
β-strand	193-198	6	4
β-strand	205-210	6	4
β-strand	215-219	5	4
β-strand	224-229	6	4
β-strand	239-244	6	5
β-strand	250-255	6	5
β-strand	260-264	5	5
α-helix	268-279	12
α-helix	288-289	2
β-strand	292-294	3	4
β-strand	299-301	3	5
β-strand	311-315	5	6
β-strand	318-322	5	6
β-strand	327-333	7	6
β-strand	350-357	8	6
β-strand	368-370	3	7
β-strand	376-380	5	7
β-strand	386-390	5	7
β-strand	400	1	7
β-strand	404	1	7
β-strand	413-418	6	1
β-strand	424-429	6	1
β-strand	433-439	7	1

Chain B: 4 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	82-89	8	8
β-strand	96-101	6	9
β-strand	105	1	10
α-helix	106	1
α-helix	110	1
β-strand	111-117	7	9
β-strand	120-126	7	9
β-strand	132-139	8	9
β-strand	147-154	8	11
β-strand	161-167	7	11
β-strand	172-176	5	11
β-strand	181-186	6	11
β-strand	193-198	6	12
β-strand	205-210	6	12
β-strand	215-219	5	12
β-strand	224-229	6	12
β-strand	239-244	6	13
β-strand	250-255	6	13
β-strand	260-264	5	13
α-helix	268-277	10
β-strand	292-294	3	12
β-strand	299-301	3	13
β-strand	311-315	5	14
β-strand	318-322	5	14
β-strand	327-333	7	14
β-strand	350-357	8	14
β-strand	368-370	3	15
β-strand	376-380	5	15
β-strand	386-390	5	15
β-strand	400	1	15
α-helix	402-403	2
β-strand	404	1	15
β-strand	413-418	6	8
β-strand	424-429	6	8
β-strand	433-439	7	8

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	41-61	21
α-helix	65-67	3

Chain D: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	41-62	22
β-strand	65	1	10
α-helix	66-67	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polycomb protein EED	A, B	protein	367	Homo sapiens	O75530 (AlphaFold model)
Histone-lysine N-methyltransferase EZH2	C, D	protein	29	Homo sapiens	Q15910 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6LO2_1 Polycomb protein EED (chains A, B)
GKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRL
LQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAIN
ELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSC
GMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRW
LGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQ
KMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASI
WRWDRLR

Sequence of entity 2 (C, D), FASTA

>6LO2_2 Histone-lysine N-methyltransferase EZH2 (chains C, D)
SMFSSNRQKILERTEILNQEWKQRRIQPV

Ligands and cofactors

ID	Name	Formula	Copies
EJU	8-[4-[(dimethylamino)methyl]phenyl]-N-[(2-methoxyphenyl)methyl]-[1,2,4]triazolo…	C23 H25 N5 O	2

Primary citation

Structure of EED in complex with EZH2 peptide and cmpd20. Zhao, K., Zhao, M., Luo, X. et al. To be published.

Other PDB entries of the same protein (UniProt O75530 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5U69 1.28 Å, Polycomb protein EED in complex with inhibitor: (3R,4S)-1-[(2-methoxyphenyl)methyl]-N,N-d…
5U8F 1.34 Å, Polycomb protein EED in complex with inhibitor: (3R,4S)-1-[(1S)-7-fluoro-2,3-dihydro-1H-i…
5U8A 1.45 Å, Polycomb protein EED in complex with inhibitor: (3R,4S)-1-[(2-bromo-6-fluorophenyl)methyl…
6SFB 1.52 Å, EED in complex with a triazolopyrimidine
3K26 1.58 Å, Complex structure of EED and trimethylated H3K4
5U5T 1.6 Å, Crystal structure of EED in complex with H3K27Me3 peptide and…
7QK4 1.6 Å, EED in complex with PRC2 allosteric inhibitor compound 22 (MAK683)
7P3C 1.61 Å, EED in complex with compound 4
6V3Y 1.63 Å, Crystal structure of EED in complex with PALI1-K1219me3 peptide
5U6D 1.64 Å, Polycomb protein EED in complex with inhibitor: 2-[4-(4-{(3S,4R)-4-(dimethylamino)-1-[(2-…
6V3X 1.7 Å, Crystal structure of EED in complex with PALI1-K1241me3 peptide
5TTW 1.74 Å, Crystal Structure of EED in Complex with UNC4859

Browse structure collections

About this viewer

MolViewer shows 6LO2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.