6LW4: Lpg2148/Lpg2149 complex

Structure of Lpg2148/Lpg2149 complex. Determined by X-ray diffraction at 2.7 Å resolution. Released 10 Feb 2021.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Chains: 2
Atoms: 3,989
Mol. weight: 56.53 kDa
Released: 10 Feb 2021

Explore 6LW4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6LW4 contains 29 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	16-31	16
α-helix	32-36	5
α-helix	40-51	12
α-helix	52-54	3
α-helix	61-70	10
α-helix	83-105	23
α-helix	107-108	2
β-strand	109-110	2	1
α-helix	116-123	8
β-strand	132-141	10	1
β-strand	146-149	4	2
α-helix	152-154	3
α-helix	161	1
β-strand	164-167	4	2
β-strand	172-175	4	2
β-strand	181-183	3	2
α-helix	188-196	9
β-strand	203-205	3	2
α-helix	209-212	4
α-helix	218-231	14
α-helix	234-236	3
β-strand	240-250	11	1
α-helix	251-253	3
β-strand	262-264	3	1
β-strand	267	1	3
β-strand	271	1	3
α-helix	273-278	6
α-helix	281-286	6
α-helix	290-302	13
α-helix	306-317	12
α-helix	319	1
α-helix	329-331	3
β-strand	337-345	9	1
α-helix	348-363	16
α-helix	370-393	24

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	11-36	26
α-helix	44-54	11
α-helix	62-64	3
α-helix	70-77	8
α-helix	79-82	4
α-helix	92-110	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Uncharacterized protein Lpg2148	A	protein	383	Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)	Q5ZTL3 (AlphaFold model)
Uncharacterized protein Lpg2149	B	protein	106	Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)	Q5ZTL2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6LW4_1 Uncharacterized protein Lpg2148 (chains A)
LESPGFMVHKKLKSMSQSYGVMMTGVPAEVLGQMQAERSIPSINKTGNLKQQIAKEVSKV
CHMMTEPTQSAGQASNDVCELLLGKIEAEKFHFTKYEALSADGDNLKNVLENTAPSSTNL
LIRFEIDREDPPIVLVKTKNENFNPETAVKNKIYLLENKLYFIDKMGNLFNLGPGKKKCT
QLFNAIGDSAEYSLCDPFVLEEPEKPEDFAISEIVDIFNEQKERFDFWIGSHSFTIYIPQ
TLGESPRQFYPYQAYFGSHTLQDWFVSDKDEYLSRIGIDKYIEKLAVLGKTTNTKERSDI
YAEFFSKRGREAFFCAHLNEKRQPLRVKFKITEINPELALKNLQETQEFIDTHPGENPSD
KVENYRNRAKLAMTEHLESLLDI

Sequence of entity 2 (B), FASTA

>6LW4_2 Uncharacterized protein Lpg2149 (chains B)
HMFFKDYQKKNVMRLLQDSLEKIINEWLKTDDESHTKLKSLQELSEMDINATSFAEHSPL
PDFVTRLWLDPHKALDAMDKNISKNEIRKLIKETAREIELVFTHQK

Primary citation

Structure of Lpg2148/Lpg2149 complex. Feng, Y., Wang, Y., Huang, Y. et al. To be published.

Other PDB entries of the same protein (UniProt Q5ZTL3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6K11 1.94 Å, Crystal structure of MvcA from Legionella pneumophila
5SUJ 2.36 Å, Crystal structure of uncharacterized protein LPG2148 from Legionella pneumophila
6JKY 2.45 Å, Crystal structure of MvcA-UBE2N-Ub complex from Legionella pneumophila
6LP2 2.48 Å, Structure of Lpg2148/UBE2N-Ub complex
5YM9 2.5 Å, Crystal Structure of the Deamidase from Legionella pneumophila
7BXF 2.7 Å, MvcA-Lpg2149 complex

Browse structure collections

About this viewer

MolViewer shows 6LW4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.