6LZP: N-terminal elongated hSNF5 RPT1 domain

The solution structure of N-terminal elongated hSNF5 RPT1 domain. Determined by solution NMR. Released 30 Dec 2020.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 700
Mol. weight: 10.08 kDa
Released: 30 Dec 2020

Explore 6LZP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6LZP contains 3 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	186-193	8	1
β-strand	200-207	8	1
α-helix	215-225	11
α-helix	230-244	15
α-helix	245-247	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1	A	protein	89	Homo sapiens	Q12824 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6LZP_1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (chains A)
GHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLN
PLTFVPAIASAIRQQIESYPTDSILEDQS

Primary citation

A Coil-to-Helix Transition Serves as a Binding Motif for hSNF5 and BAF155 Interaction. Han, J., Kim, I., Park, J.H. et al. Int J Mol Sci (2020) 21. DOI 10.3390/ijms21072452 · PubMed

Other PDB entries of the same protein (UniProt Q12824 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GJK 2.05 Å, Crystal Structure of BAF47 and BAF155 Complex
5L7A 2.1 Å, The crystal structure of the Human SNF5/INI1 domain
6KZ7 2.28 Å, The crystal structure of BAF155 SWIRM domain and N-terminal elongated hSNF5 RPT1 domain…
6KAG 2.6 Å, Crystal structure of the SMARCB1/SMARCC2 subcomplex
6LTH 3.0 Å, Structure of human BAF Base module
7VDV 3.4 Å, The overall structure of human chromatin remodeling PBAF-nucleosome complex
9RL4 3.5 Å, Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL-6
6LTJ 3.7 Å, Structure of nucleosome-bound human BAF complex
9RN2 4.1 Å, Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 2
9RMC 4.2 Å, Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 1
7Y8R 4.4 Å, The nucleosome-bound human PBAF complex
9RN1 5.9 Å, Structure of BAF-nucleosome complex with OCT4-SOX2 at SHL+6 in ADP-bound state, BAF47…

Browse structure collections

About this viewer

MolViewer shows 6LZP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.