6M8F: Myoglobin

Name: PDB 6M8F: Engineered sperm whale myoglobin-based carbene transferase
Published: 2019-01-23
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Engineered sperm whale myoglobin-based carbene transferase. Determined by X-ray diffraction at 1.1 Å resolution. Released 23 Jan 2019.

Method: X-ray diffraction
Resolution: 1.1 Å
Organism: Physeter catodon
Chains: 1
Atoms: 1,589
Mol. weight: 18.55 kDa
Ligands: HEM
Released: 23 Jan 2019

Explore 6M8F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6M8F contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	4-17	14
α-helix	21-35	15
α-helix	37-42	6
α-helix	52-57	6
α-helix	59-77	19
α-helix	83-91	9
α-helix	92-96	5
α-helix	101-118	18
α-helix	120-122	3
α-helix	125-148	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myoglobin	A	protein	154	Physeter catodon	P02185 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6M8F_1 Myoglobin (chains A)
MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASE
DLKKVGVTALTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH
PGNFGADAQGAMNKALELFRKDIAAKYKELGYQG

Ligands and cofactors

ID	Name	Formula	Copies
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Origin of high stereocontrol in olefin cyclopropanation catalyzed by an engineered carbene transferase. Tinoco, A., Wei, Y., Bacik, J.P. et al. ACS Catal (2019) 9:1514-1524. DOI 10.1021/acscatal.8b04073 · PubMed

Other PDB entries of the same protein (UniProt P02185 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YCE 0.77 Å, Sperm whale myoglobin swMb
7VDN 0.93 Å, High resolution crystal structure of Sperm Whale Myoglobin in the carbonmonoxy form
1A6M 1.0 Å, Oxy-myoglobin, atomic resolution
1NAZ 1.04 Å, structure of microgravity-grown oxidized myoglobin mutant YQR (ISS8A)
8ESU 1.04 Å, Myoglobin variant Mb-imi complex
1A6K 1.1 Å, Aquomet-myoglobin, atomic resolution
2EKT 1.1 Å, Crystal structure of myoglobin reconstituted with 6-methyl-6-depropionatehemin
3O89 1.1 Å, Crystal Structure of Sperm Whale Myoglobin G65T
9P1F 1.1 Å, Myoglobin variant RR22 in complex with imidazole
4H07 1.14 Å, Complex of G65T Myoglobin with Phenol in its Proximal Cavity
1A6G 1.15 Å, Carbonmonoxy-myoglobin, atomic resolution
1A6N 1.15 Å, Deoxy-myoglobin, atomic resolution

Browse structure collections

About this viewer

MolViewer shows 6M8F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.