SETD3, a Histidine Methyltransferase, in Complex with an Actin Peptide and SAH, First P212121 Crystal Form. Determined by X-ray diffraction at 1.69 Å resolution. Released 19 Dec 2018.
Explore 6MBK in 3D Show helices and sheets RCSB PDB PDBe
6MBK contains 57 α-helices and 34 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 21-35 | 15 | |
| α-helix | 38-39 | 2 | |
| α-helix | 42-44 | 3 | |
| α-helix | 45-61 | 17 | |
| α-helix | 74-77 | 4 | |
| α-helix | 78-87 | 10 | |
| β-strand | 95-100 | 6 | 2 |
| β-strand | 104-109 | 6 | 2 |
| β-strand | 113 | 1 | 3 |
| β-strand | 118-123 | 6 | 1 |
| α-helix | 124-126 | 3 | |
| β-strand | 128-129 | 2 | 4 |
| α-helix | 130-134 | 5 | |
| α-helix | 139-142 | 4 | |
| α-helix | 146-150 | 5 | |
| α-helix | 152-164 | 13 | |
| α-helix | 172-175 | 4 | |
| α-helix | 185-187 | 3 | |
| α-helix | 190-194 | 5 | |
| α-helix | 202-225 | 24 | |
| α-helix | 227-229 | 3 | |
| α-helix | 240-253 | 14 | |
| β-strand | 255-258 | 4 | 4 |
| β-strand | 265-269 | 5 | 4 |
| α-helix | 273-275 | 3 | |
| α-helix | 276 | 1 | |
| β-strand | 277-278 | 2 | 5 |
| β-strand | 285-288 | 4 | 1 |
| β-strand | 293-297 | 5 | 1 |
| β-strand | 302 | 1 | 3 |
| β-strand | 307-308 | 2 | 2 |
| β-strand | 309-310 | 2 | 5 |
| α-helix | 317-324 | 8 | |
| β-strand | 335-341 | 7 | 6 |
| α-helix | 349-358 | 10 | |
| β-strand | 364-370 | 7 | 6 |
| α-helix | 378-387 | 10 | |
| α-helix | 391-398 | 8 | |
| α-helix | 403-408 | 6 | |
| α-helix | 419-437 | 19 | |
| α-helix | 444-453 | 10 | |
| β-strand | 457 | 1 | 7 |
| α-helix | 458-494 | 37 | |
| α-helix | 496-499 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 21-35 | 15 | |
| α-helix | 38-39 | 2 | |
| α-helix | 42-44 | 3 | |
| α-helix | 45-61 | 17 | |
| α-helix | 74-77 | 4 | |
| α-helix | 78-87 | 10 | |
| β-strand | 95-100 | 6 | 7 |
| β-strand | 104-109 | 6 | 7 |
| β-strand | 113 | 1 | 9 |
| β-strand | 118-123 | 6 | 8 |
| α-helix | 124-126 | 3 | |
| β-strand | 128-129 | 2 | 10 |
| α-helix | 130-134 | 5 | |
| α-helix | 139-144 | 6 | |
| α-helix | 146-150 | 5 | |
| α-helix | 152-164 | 13 | |
| α-helix | 172-175 | 4 | |
| α-helix | 185-187 | 3 | |
| α-helix | 190-194 | 5 | |
| α-helix | 202-225 | 24 | |
| α-helix | 227-229 | 3 | |
| α-helix | 233-235 | 3 | |
| α-helix | 240-253 | 14 | |
| β-strand | 255-258 | 4 | 10 |
| β-strand | 265-269 | 5 | 10 |
| α-helix | 273-275 | 3 | |
| α-helix | 276 | 1 | |
| β-strand | 277-278 | 2 | 11 |
| β-strand | 285-288 | 4 | 8 |
| β-strand | 293-297 | 5 | 8 |
| β-strand | 302 | 1 | 9 |
| β-strand | 307-308 | 2 | 7 |
| β-strand | 309-310 | 2 | 11 |
| α-helix | 317-324 | 8 | |
| β-strand | 335-341 | 7 | 12 |
| α-helix | 349-359 | 11 | |
| β-strand | 364-370 | 7 | 12 |
| α-helix | 378-387 | 10 | |
| α-helix | 391-398 | 8 | |
| α-helix | 403-408 | 6 | |
| α-helix | 419-437 | 19 | |
| α-helix | 444-453 | 10 | |
| β-strand | 457 | 1 | 2 |
| α-helix | 458-494 | 37 | |
| α-helix | 496-499 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 70 | 1 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Actin peptide | Y, Z | protein | 15 | Homo sapiens | P60709 (AlphaFold model) |
| Histone-lysine N-methyltransferase setd3 | A, B | protein | 599 | Homo sapiens | Q86TU7 (AlphaFold model) |
>6MBK_1 Actin peptide (chains Y, Z) TLKYPIEHGIVTNWD
>6MBK_2 Histone-lysine N-methyltransferase setd3 (chains A, B) GPLGSMGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEYVQIRT LVEKIRKKQKGLSVTFDGKREDYFPDLMKWASENGASVEGFEMVNFKEEGFGLRATRDIK AEELFLWVPRKLLMTVESAKNSVLGPLYSQDRILQAMGNIALAFHLLCERASPNSFWQPY IQTLPSEYDTPLYFEEDEVRYLQSTQAIHDVFSQYKNTARQYAYFYKVIQTHPHANKLPL KDSFTYEDYRWAVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHTNGLITTGYNLEDDRC ECVALQDFRAGEQIYIFYGTRSNAEFVIHSGFFFDNNSHDRVKIKLGVSKSDRLYAMKAE VLARAGIPTSSVFALHFTEPPISAQLLAFLRVFCMTEEELKEHLLGDSAIDRIFTLGNSE FPVSWDNEVKLWTFLEDRASLLLKTYKTTIEEDKSVLKNHDLSVRAKMAIKLRLGEKEIL EKAVKSAAVNREYYRQQMEEKAPLPKYEESNLGLLESSVGDSRLPLVLRNLEEEAGVQDA LNIREAISKAKATENGLVNGENSIPNGTRSENESLNQESKRAVEDAKGSSSDSTAGVKE
| ID | Name | Formula | Copies |
|---|---|---|---|
| SAH | S-adenosyl-L-homocysteine | C14 H20 N6 O5 S | 2 |
Water and common crystallization additives (EDO, GOL, SO4) are not listed.
SETD3 is an actin histidine methyltransferase that prevents primary dystocia. Wilkinson, A.W., Diep, J., Dai, S. et al. Nature (2019) 565:372-376. DOI 10.1038/s41586-018-0821-8 · PubMed
Other PDB entries of the same protein (UniProt P60709 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6MBK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.