6MG1: CCAAT/enhancer-binding protein beta

C-terminal bZIP domain of human C/EBPbeta with 16bp Methylated Oligonucleotide Containing Consensus Recognition Sequence-C2 Crystal Form. Determined by X-ray diffraction at 1.75 Å resolution. Released 12 Dec 2018.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,914
Mol. weight: 28.84 kDa
Released: 12 Dec 2018

Explore 6MG1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MG1 contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	272-329	58

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	272-330	59

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CCAAT/enhancer-binding protein beta	A, B	protein	78	Homo sapiens	P17676 (AlphaFold model)
16-bp methylated oligonucleotide	C, D	DNA	16	Homo sapiens

Sequence of entity 1 (A, B), FASTA

>6MG1_1 CCAAT/enhancer-binding protein beta (chains A, B)
HMKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELST
LRNLFKQLPEPLLASSGH

Sequence of entity 2 (C, D), FASTA

>6MG1_2 16-bp methylated oligonucleotide (chains C, D)
TATATTGCGCAATATA

Primary citation

Structural basis for effects of CpA modifications on C/EBP beta binding of DNA. Yang, J., Horton, J.R., Wang, D. et al. Nucleic Acids Res (2019) 47:1774-1785. DOI 10.1093/nar/gky1264 · PubMed

Other PDB entries of the same protein (UniProt P17676 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7L4V 1.75 Å, C-terminal bZIP domain of human C/EBPbeta Bound to DNA with Consensus Recognition with…
1GU4 1.8 Å, Crystal structure of C/EBPBETA BZIP homodimer bound to a high affinity DNA fragment
2E42 1.8 Å, Crystal structure of C/EBPbeta Bzip homodimer V285A mutant bound to A High Affinity DNA…
1GTW 1.85 Å, crystal structure of C/EBPbeta bZip homodimer bound to a DNA fragment from the tom-1A…
6MG2 1.93 Å, C-terminal bZIP domain of human C/EBPbeta with 16bp Methylated Oligonucleotide…
6MG3 2.05 Å, V285A Mutant of the C-terminal bZIP domain of human C/EBPbeta with 16bp Methylated…
1GU5 2.1 Å, Crystal structure of C/EBPBETA BZIP homodimer bound to a DNA fragment from the MIM-1…
2E43 2.1 Å, Crystal structure of C/EBPbeta Bzip homodimer K269A mutant bound to A High Affinity DNA…
8K8D 2.2 Å, Crystal structure of C/EBPbeta BZIP domain bound to a high affinity DNA
1H8A 2.23 Å, Crystal structure of ternary protein-DNA COMPLEX3
1H89 2.45 Å, Crystal structure of ternary protein-DNA COMPLEX2
7UPZ 2.49 Å, Structural basis for cell type specific DNA binding of C/EBPbeta: the case of cell cycle…

Browse structure collections

About this viewer

MolViewer shows 6MG1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.