6MJ8: Candida glabrata Csm1:Mam1 complex

Structure of Candida glabrata Csm1:Mam1 complex. Determined by X-ray diffraction at 3.03 Å resolution. Released 7 Nov 2018.

Method: X-ray diffraction
Resolution: 3.03 Å
Organism: Candida glabrata
Chains: 4
Atoms: 1,944
Mol. weight: 39.71 kDa
Released: 7 Nov 2018

Explore 6MJ8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MJ8 contains 16 α-helices and 10 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	71-82	12
β-strand	84-91	8	1
β-strand	96-103	8	1
β-strand	108-115	8	1
β-strand	129-134	6	1
α-helix	141-150	10
α-helix	154-156	3
β-strand	159-162	4	1
α-helix	163-165	3
α-helix	166-178	13

Chain B: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	72-82	11
β-strand	84-91	8	2
β-strand	96-103	8	2
β-strand	108-115	8	2
β-strand	129-134	6	2
α-helix	141-150	10
α-helix	153-156	4
β-strand	159-162	4	2
α-helix	163-165	3
α-helix	166-177	12

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	168-170	3
α-helix	171-177	7
α-helix	179-181	3

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	171-174	4
α-helix	175-177	3
α-helix	179-182	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Monopolin complex subunit CSM1	A, B	protein	113	Candida glabrata	Q6FVN3 (AlphaFold model)
Mam1	C, D	protein	55	Candida glabrata	Q6FTD4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6MJ8_1 Monopolin complex subunit CSM1 (chains A, B)
ETIEIIKDLFEHLCGVRVHRTYEDDTGLWFDTSQGSKNGIMDYKLGFVKSQAENTTEVDT
EVIYVPLLKQRTAEELQELQKKLPDYLFETLSFPLRSLNQFYIKMSKSLNKKV

Sequence of entity 2 (C, D), FASTA

>6MJ8_2 Mam1 (chains C, D)
NVQKYIPPTILTKRRNMESFNDCKVNTKDIISFKDVNQEYETWLDKHLSLAKDRD

Primary citation

The molecular basis of monopolin recruitment to the kinetochore. Plowman, R., Singh, N., Tromer, E.C. et al. Chromosoma (2019) 128:331-354. DOI 10.1007/s00412-019-00700-0 · PubMed

Other PDB entries of the same protein (UniProt Q6FVN3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MJC 1.79 Å, Structure of Candida glabrata Csm1:Dsn1(43-67DD) complex
6MJB 2.27 Å, Structure of Candida glabrata Csm1:Dsn1(14-72) complex
6MJE 2.5 Å, Structure of Candida glabrata Csm1: S. cerevisiae Dsn1 complex

Browse structure collections

About this viewer

MolViewer shows 6MJ8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.