6MJE: Monopolin complex subunit CSM1

Structure of Candida glabrata Csm1: S. cerevisiae Dsn1 complex. Determined by X-ray diffraction at 2.5 Å resolution. Released 7 Nov 2018.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: Candida glabrata, Saccharomyces cerevisiae
Chains: 8
Atoms: 4,561
Mol. weight: 81.34 kDa
Released: 7 Nov 2018

Explore 6MJE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MJE contains 31 α-helices and 24 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, C, E and G: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	67-82	16
β-strand	84-91	8	1
β-strand	96-103	8	1
β-strand	108-115	8	1
β-strand	129-135	7	1
α-helix	141-150	10
α-helix	153-156	4
β-strand	159-162	4	1
α-helix	163-165	3
α-helix	166-178	13

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	74-78	5
α-helix	88-100	13
β-strand	102-103	2	1

Chains D, F and H: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	74-78	5
α-helix	88-100	13
α-helix	101	1
β-strand	102-103	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Monopolin complex subunit CSM1	A, C, E, G	protein	132	Candida glabrata	Q6FVN3 (AlphaFold model)
Dsn1p	B, D, F, H	protein	40	Saccharomyces cerevisiae	P40568 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>6MJE_1 Monopolin complex subunit CSM1 (chains A, C, E, G)
MKSSHHHHHHENLYFQSNAETIEIIKDLFEHLCGVRVHRTYEDDTGLWFDTSQGSKNGIM
DYKLGFVKSQAENTTEVDTEVIYVPLLKQRTAEELQELQKKLPDYLFETLSFPLRSLNQF
YIKMSKSLNKKV

Sequence of entity 2 (B, D, F, H), FASTA

>6MJE_2 Dsn1p (chains B, D, F, H)
DLKFKRHKNKHIQGFPTLGERLDNLQDIKKAKRVENFNSS

Primary citation

The molecular basis of monopolin recruitment to the kinetochore. Plowman, R., Singh, N., Tromer, E.C. et al. Chromosoma (2019) 128:331-354. DOI 10.1007/s00412-019-00700-0 · PubMed

Other PDB entries of the same protein (UniProt Q6FVN3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MJC 1.79 Å, Structure of Candida glabrata Csm1:Dsn1(43-67DD) complex
6MJB 2.27 Å, Structure of Candida glabrata Csm1:Dsn1(14-72) complex
6MJ8 3.03 Å, Structure of Candida glabrata Csm1:Mam1 complex

Browse structure collections

About this viewer

MolViewer shows 6MJE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.