6MKZ: Murine 4-1BB/4-1BBL complex

Crystal structure of murine 4-1BB/4-1BBL complex. Determined by X-ray diffraction at 2.65 Å resolution. Released 19 Dec 2018.

Method: X-ray diffraction
Resolution: 2.65 Å
Organism: Mus musculus
Chains: 4
Atoms: 4,179
Mol. weight: 69.98 kDa
Released: 19 Dec 2018

Explore 6MKZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MKZ contains 16 α-helices and 53 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	148-154	7	1
β-strand	162-163	2	2
α-helix	164	1
β-strand	165-167	3	1
β-strand	172	1	3
β-strand	176-177	2	1
β-strand	181-184	4	2
β-strand	189-192	4	2
β-strand	196-208	13	1
β-strand	210	1	4
β-strand	218-227	10	2
β-strand	239-243	5	2
α-helix	247-249	3
β-strand	253-263	11	1
β-strand	267-278	12	2
α-helix	283-285	3
β-strand	287-289	3	1
β-strand	296-304	9	1

Chain B: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	35-36	2	5
β-strand	45-46	2	5
α-helix	47-48	2
β-strand	51-52	2	6
β-strand	58	1	5
β-strand	61	1	7
β-strand	62-63	2	6
α-helix	64-65	2
β-strand	71-75	5	8
α-helix	76-77	2
β-strand	84-87	4	8
β-strand	91-94	4	9
β-strand	100-103	4	9
α-helix	104-106	3
β-strand	109-110	2	10
β-strand	117-118	2	10
β-strand	124	1	11
β-strand	134	1	11

Chain C: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	148-154	7	12
β-strand	162-163	2	13
α-helix	164	1
β-strand	165-167	3	12
β-strand	172	1	7
β-strand	176-177	2	12
β-strand	181-184	4	13
β-strand	189-192	4	13
β-strand	196-208	13	12
β-strand	210	1	9
β-strand	218-228	11	13
α-helix	230-231	2
β-strand	238-243	6	13
α-helix	245-249	5
β-strand	253-263	11	12
β-strand	267-278	12	13
α-helix	284-286	3
β-strand	287-289	3	12
β-strand	296-304	9	12

Chain D: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	31-32	2
β-strand	35-36	2	14
β-strand	45-46	2	14
α-helix	47-48	2
β-strand	51-52	2	15
β-strand	61	1	3
β-strand	62-63	2	15
α-helix	64-65	2
β-strand	71-75	5	16
α-helix	76-77	2
β-strand	84-87	4	16
α-helix	88	1
β-strand	91-94	4	4
β-strand	100-103	4	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor ligand superfamily member 9	A, C	protein	171	Mus musculus	P41274 (AlphaFold model)
Tumor necrosis factor receptor superfamily member 9	B, D	protein	139	Mus musculus	P20334 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>6MKZ_1 Tumor necrosis factor ligand superfamily member 9 (chains A, C)
NTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLY
YVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWS
QLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE

Sequence of entity 2 (B, D), FASTA

>6MKZ_2 Tumor necrosis factor receptor superfamily member 9 (chains B, D)
DPVQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTH
NAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSL
DGRSVLKTGTTEKDVVCGP

Primary citation

Crystal structure of the m4-1BB/4-1BBL complex reveals an unusual dimeric ligand that undergoes structural changes upon 4-1BB receptor binding. Bitra, A., Doukov, T., Destito, G. et al. J Biol Chem (2019) 294:1831-1845. DOI 10.1074/jbc.RA118.006297 · PubMed

Other PDB entries of the same protein (UniProt P41274 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MKB 2.5 Å, Crystal structure of murine 4-1BB ligand

Browse structure collections

About this viewer

MolViewer shows 6MKZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.