Crystal structure of ABIN-1 UBAN. Determined by X-ray diffraction at 3.0 Å resolution. Released 17 Jul 2019.
Explore 6N6S in 3D Show helices and sheets RCSB PDB PDBe
6N6S contains 4 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 466-528 | 63 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 465-526 | 62 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 462-527 | 66 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 465-531 | 67 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| TNFAIP3-interacting protein 1 | A, B, C, D | protein | 72 | Mus musculus | Q9WUU8 (AlphaFold model) |
>6N6S_1 TNFAIP3-interacting protein 1 (chains A, B, C, D) GSLRKQELVTQNELLKQQVKIFEEDFQRERSDRERMNEEKEELKKQVEKLQAQVTLTNAQ LKTLKEEEKAKE
Molecular Recognition of M1-Linked Ubiquitin Chains by Native and Phosphorylated UBAN Domains. Herhaus, L., van den Bedem, H., Tang, S. et al. J Mol Biol (2019) 431:3146-3156. DOI 10.1016/j.jmb.2019.06.012 · PubMed
Other PDB entries of the same protein (UniProt Q9WUU8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6N6S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.