Crystal structure of ABIN-1 UBAN in complex with two M1-linked di-ubiquitins. Determined by X-ray diffraction at 1.95 Å resolution. Released 17 Jul 2019.
Explore 6N6R in 3D Show helices and sheets RCSB PDB PDBe
6N6R contains 16 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-6 | 5 | 1 |
| β-strand | 12-16 | 5 | 1 |
| β-strand | 22 | 1 | 2 |
| α-helix | 23-34 | 12 | |
| α-helix | 38-40 | 3 | |
| β-strand | 41-45 | 5 | 1 |
| β-strand | 48-49 | 2 | 1 |
| α-helix | 50-51 | 2 | |
| β-strand | 55 | 1 | 2 |
| α-helix | 57-59 | 3 | |
| β-strand | 66-71 | 6 | 1 |
| β-strand | 77-83 | 7 | 3 |
| β-strand | 88-93 | 6 | 3 |
| β-strand | 98 | 1 | 4 |
| α-helix | 99-110 | 12 | |
| α-helix | 114-116 | 3 | |
| β-strand | 117-121 | 5 | 3 |
| β-strand | 124-125 | 2 | 3 |
| α-helix | 126-127 | 2 | |
| β-strand | 131 | 1 | 4 |
| α-helix | 133-135 | 3 | |
| β-strand | 142-147 | 6 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 465-529 | 65 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-7 | 6 | 5 |
| β-strand | 12-16 | 5 | 5 |
| β-strand | 22 | 1 | 6 |
| α-helix | 23-33 | 11 | |
| α-helix | 38-40 | 3 | |
| β-strand | 41-45 | 5 | 5 |
| β-strand | 48-49 | 2 | 5 |
| β-strand | 55 | 1 | 6 |
| β-strand | 66-71 | 6 | 5 |
| β-strand | 77-83 | 7 | 7 |
| β-strand | 88-93 | 6 | 7 |
| β-strand | 98 | 1 | 8 |
| α-helix | 99-110 | 12 | |
| α-helix | 114-116 | 3 | |
| β-strand | 117-121 | 5 | 7 |
| β-strand | 124-125 | 2 | 7 |
| α-helix | 126-127 | 2 | |
| β-strand | 131 | 1 | 8 |
| α-helix | 133-135 | 3 | |
| β-strand | 142-147 | 6 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 466-530 | 65 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin | A, C | protein | 157 | Homo sapiens | P0CG48 (AlphaFold model) |
| TNFAIP3-interacting protein 1 | B, D | protein | 70 | Mus musculus | Q9WUU8 (AlphaFold model) |
>6N6R_1 Ubiquitin (chains A, C) GSGSGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPD QQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG
>6N6R_2 TNFAIP3-interacting protein 1 (chains B, D) LRKQELVTQNELLKQQVKIFEEDFQRERSDRERMNEEKEELKKQVEKLQAQVTLTNAQLK TLKEEEKAKE
Molecular Recognition of M1-Linked Ubiquitin Chains by Native and Phosphorylated UBAN Domains. Herhaus, L., van den Bedem, H., Tang, S. et al. J Mol Biol (2019) 431:3146-3156. DOI 10.1016/j.jmb.2019.06.012 · PubMed
Other PDB entries of the same protein (UniProt P0CG48 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6N6R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.