6N8U: PDB entry 6N8U

Name: PDB 6N8U: DRAFT model of Schistosoma japonicum Glutathione S-transferase expression tag
Published: 2019-01-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

DRAFT model of Schistosoma japonicum Glutathione S-transferase expression tag. Determined by X-ray diffraction at 1.96 Å resolution. Released 16 Jan 2019.

Method: X-ray diffraction
Resolution: 1.96 Å
Organism: Schistosoma japonicum
Chains: 2
Atoms: 3,495
Mol. weight: 56.65 kDa
Released: 16 Jan 2019

Explore 6N8U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6N8U contains 21 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	1
α-helix	12-14	3
α-helix	15-24	10
β-strand	29-33	5	1
α-helix	34	1
α-helix	35-37	3
α-helix	38-44	7
β-strand	57-60	4	1
β-strand	63-66	4	1
α-helix	68-78	11
α-helix	86-110	25
α-helix	115-136	22
β-strand	142	1	2
β-strand	145	1	2
α-helix	150-165	16
α-helix	174-184	11
α-helix	187-194	8

Chain B: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	3
α-helix	12-14	3
α-helix	15-23	9
β-strand	29-33	5	3
α-helix	34	1
α-helix	38-44	7
β-strand	57-59	3	3
β-strand	64-66	3	3
α-helix	68-77	10
α-helix	86-110	25
α-helix	115-136	22
β-strand	142	1	4
β-strand	145	1	4
α-helix	150-165	16
α-helix	174-185	12
α-helix	187-194	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutathione S-transferase class-mu 26 kDa isozyme	A, B	protein	240	Schistosoma japonicum	P08515 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6N8U_1 Glutathione S-transferase class-mu 26 kDa isozyme (chains A, B)
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYID
GDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKV
DFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFK
KRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSSMGSSHHHHHHSSGLVPR

Primary citation

DRAFT model of Schistosoma japonicum Glutathione S-transferase expression tag. Tempel, W., Dong, C. To be published.

Other PDB entries of the same protein (UniProt P08515 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8OK1 1.38 Å, WD repeat containing protein 5 (WDR5)- N225A mutant
6JI6 1.5 Å, Crystal structure of glutathione S-transferase complexed and modified with glutathione
6RWD 1.53 Å, Crystal structure of SjGST in complex with GSH and ellagic acid at 1.53 Angstrom…
4WR4 1.6 Å, Crystal Structure of GST Mutated with Halogenated Tyrosine (7bGST-1)
9NME 1.6 Å, SARS-CoV-2 3CLPro in complex with 2-[2-hydroxy-3-(4-isoquinolyl)-4-oxo-6-(trifluoromethyl…
8GYD 1.7 Å, Structure of Schistosoma japonicum Glutathione S-transferase bound with the ligand…
9N4U 1.77 Å, Crystal structure of PAK1 bound to compound R1
1DUG 1.8 Å, Structure of the fibrinogen G chain integrin binding and factor xiiia crosslinking sites…
9NMF 1.8 Å, SARS-CoV-2 3CLPro in complex with 8-(6-amino-3-pyridyl)-2-hydroxy-3-(4-isoquinolyl)-6-(tr…
7AL7 1.8 Å, The Crystal Structure of Human IL-18 in Complex With Human IL-18 Binding Protein
8OKF 1.85 Å, WD repeat containing protein 5 (WDR5)- PER2 peptide
9N48 1.85 Å, Crystal structure of PAK1 bound to compound C1

Browse structure collections

About this viewer

MolViewer shows 6N8U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.