6NIF: Human REV7-RAN complex

crystal structure of human REV7-RAN complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 11 Sept 2019.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,859
Mol. weight: 28.73 kDa
Released: 11 Sept 2019

Explore 6NIF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6NIF contains 9 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	12-33	22
α-helix	39-41	3
β-strand	42-47	6	1
β-strand	50-55	6	1
α-helix	58-76	19
β-strand	80-88	9	2
β-strand	94-103	10	2
α-helix	116-133	18
α-helix	138-141	4
β-strand	145-152	8	2
α-helix	155-156	2
β-strand	171-173	3	2
α-helix	176-179	4
α-helix	184	1
β-strand	185-193	9	2
β-strand	198-205	8	2
β-strand	502-505	4	2
α-helix	508-511	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
hREV7, GTP-binding nuclear protein Ran, hREV3 fusion	A	protein	260	Homo sapiens	P62826 (AlphaFold model), Q9UI95 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6NIF_1 hREV7, GTP-binding nuclear protein Ran, hREV3 fusion (chains A)
GTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPEL
NQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVE
QLLAAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVH
MHDPRLIPLKTMTSDILKMQLYVEERAHKGSGSGSGSGSGSGSGSGSGSGSKLIGDPNLE
FVAMPALAPPASREEIMATL

Primary citation

REV7 has a dynamic adaptor region to accommodate small GTPase RAN/ShigellaIpaB ligands, and its activity is regulated by the RanGTP/GDP switch. Wang, X., Pernicone, N., Pertz, L. et al. J Biol Chem (2019) 294:15733-15742. DOI 10.1074/jbc.RA119.010123 · PubMed

Other PDB entries of the same protein (UniProt P62826 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3GJ0 1.48 Å, Crystal structure of human RanGDP
7MO5 1.55 Å, Crystal Structure of the ZnF4 of Nucleoporin NUP153 in complex with Ran-GDP
7MO1 1.6 Å, Crystal Structure of the ZnF1 of Nucleoporin NUP153 in complex with Ran-GDP
5CIQ 1.65 Å, Ran GDP wild type tetragonal crystal form
7MO2 1.65 Å, Crystal Structure of the ZnF2 of Nucleoporin NUP153 in complex with Ran-GDP
5CIT 1.75 Å, Ran GDP wild type monoclinic crystal form
5CIW 1.75 Å, Ran GDP Y39A mutant monoclinic crystal form
5CJ2 1.75 Å, Ran GDP Y39A mutant triclinic crystal form
1I2M 1.76 Å, Ran-RCC1-SO4 complex
4HAT 1.78 Å, Crystal structure of CRM1 inhibitor Leptomycin B in complex with CRM1-Ran-RanBP1
3GJ3 1.79 Å, Crystal structure of human RanGDP-Nup153ZnF2 complex
3GJ5 1.79 Å, Crystal structure of human RanGDP-Nup153ZnF4 complex

Browse structure collections

About this viewer

MolViewer shows 6NIF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.