6NK3: Murine Mxra8 ectodomain

Crystal structure of murine Mxra8 ectodomain. Determined by X-ray diffraction at 2.2 Å resolution. Released 22 May 2019.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Mus musculus
Chains: 2
Atoms: 4,523
Mol. weight: 62.33 kDa
Released: 22 May 2019

Explore 6NK3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6NK3 contains 20 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	34-44	11	1
β-strand	49-51	3	2
β-strand	54	1	3
α-helix	56-58	3
β-strand	70-77	8	4
β-strand	85-91	7	4
β-strand	97-98	2	4
α-helix	101-103	3
β-strand	107-109	3	5
α-helix	113-116	4
β-strand	118	1	6
β-strand	121-123	3	5
α-helix	128-130	3
β-strand	132-140	9	4
β-strand	145-156	12	4
α-helix	159-161	3
β-strand	164-166	3	4
β-strand	171-176	6	4
β-strand	181-183	3	5
β-strand	186	1	6
β-strand	203-209	7	1
α-helix	218	1
β-strand	219-225	7	1
β-strand	230-232	3	1
α-helix	236-239	4
β-strand	242-243	2	2
α-helix	248-251	4
β-strand	253	1	3
β-strand	256-258	3	2
α-helix	263-265	3
β-strand	267-275	9	1
β-strand	280-291	12	1
α-helix	292-293	2

Chain B: 10 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	34-44	11	7
β-strand	49-51	3	8
β-strand	54	1	9
α-helix	56-58	3
α-helix	66-68	3
β-strand	70-76	7	10
β-strand	85-91	7	10
β-strand	97-98	2	10
α-helix	101-103	3
β-strand	107-108	2	11
α-helix	113-116	4
β-strand	118	1	12
β-strand	121-123	3	11
α-helix	128-130	3
β-strand	132-140	9	10
β-strand	145-156	12	10
α-helix	159-161	3
β-strand	163-166	4	10
β-strand	171-176	6	10
β-strand	181-183	3	11
β-strand	186	1	12
β-strand	203-209	7	7
α-helix	218	1
β-strand	219-225	7	7
β-strand	230-232	3	7
α-helix	236-239	4
β-strand	242-243	2	8
α-helix	246-251	6
β-strand	253	1	9
β-strand	256-258	3	8
α-helix	263-265	3
β-strand	267-275	9	7
β-strand	280-291	12	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Matrix remodeling-associated protein 8	A, B	protein	274	Mus musculus	Q9DBV4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6NK3_1 Matrix remodeling-associated protein 8 (chains A, B)
SGPSGTAAASSSLVSESVVSLAAGTQAVLRCQSPRMVWTQDRLHDRQRVVHWDLSGGPGS
QRRRLVDMYSAGEQRVYEPRDRDRLLLSPSAFHDGNFSLLIRAVDRGDEGVYTCNLHHHY
CHLDESLAVRLEVTEDPLLSRAYWDGEKEVLVVAHGAPALMTCINRAHVWTDRHLEEAQQ
VVHWDRQLPGVSHDRADRLLDLYASGERRAYGPPFLRDRVSVNTNAFARGDFSLRIDELE
RADEGIYSCHLHHHYCGLHERRVFHLQVTEPAFE

Primary citation

Cryo-EM Structure of Chikungunya Virus in Complex with the Mxra8 Receptor. Basore, K., Kim, A.S., Nelson, C.A. et al. Cell (2019) 177:1725. DOI 10.1016/j.cell.2019.04.006 · PubMed

Other PDB entries of the same protein (UniProt Q9DBV4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JO7 2.4 Å, Crystal structure of mouse MXRA8
8SQN 3.89 Å, CryoEM structure of Western equine encephalitis virus VLP in complex with the chimeric…
8EWF 3.92 Å, CryoEM structure of Western equine encephalitis virus VLP in complex with the avian…
6NK6 4.06 Å, Electron Cryo-Microscopy Of Chikungunya VLP in complex with mouse Mxra8 receptor
6NK7 4.99 Å, Electron Cryo-Microscopy of Chikungunya in Complex with Mouse Mxra8 Receptor

Browse structure collections

About this viewer

MolViewer shows 6NK3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.