Hypoxia-Inducible Factor (HIF) Prolyl Hydroxylase 2 (PHD2) in Complex with the Carboxamide Analog JNJ43058171. Determined by X-ray diffraction at 1.58 Å resolution. Released 24 Apr 2019.
Explore 6NMQ in 3D Show helices and sheets RCSB PDB PDBe
6NMQ contains 7 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 190-193 | 4 | |
| α-helix | 194-198 | 5 | |
| α-helix | 199-205 | 7 | |
| β-strand | 207-210 | 4 | 1 |
| α-helix | 216-231 | 16 | |
| β-strand | 255-259 | 5 | 1 |
| α-helix | 267-281 | 15 | |
| β-strand | 294-295 | 2 | 1 |
| α-helix | 296-297 | 2 | |
| β-strand | 298-303 | 6 | 1 |
| β-strand | 308-313 | 6 | 2 |
| β-strand | 322-329 | 8 | 1 |
| β-strand | 331 | 1 | 3 |
| α-helix | 336-339 | 4 | |
| β-strand | 340 | 1 | 2 |
| β-strand | 343-345 | 3 | 2 |
| β-strand | 354-356 | 3 | 2 |
| β-strand | 359 | 1 | 3 |
| β-strand | 363-367 | 5 | 1 |
| β-strand | 374-379 | 6 | 2 |
| β-strand | 383-391 | 9 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Egl nine homolog 1 | A | protein | 213 | Homo sapiens | Q9GZT9 (AlphaFold model) |
>6NMQ_1 Egl nine homolog 1 (chains A) RPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQ LVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAM VACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPK FDRLLFFWSDRRNPHEVQPAYATRYAITVWYFD
| ID | Name | Formula | Copies |
|---|---|---|---|
| KU1 | N-(4-oxo-1,4-dihydrocinnoline-3-carbonyl)glycine | C11 H9 N3 O4 | 1 |
| FE2 | FE (II) ion | Fe | 1 |
Beyond Traditional Structure-Based Drug Design: The Role of Iron Complexation, Strain, and Water in the Binding of Inhibitors for Hypoxia-Inducible Factor Prolyl Hydroxylase 2. Bembenek, S.D., Venkatesan, H., Peltier, H.M. et al. ACS Omega (2019) 4:6703-6708. DOI 10.1021/acsomega.9b00199 · PubMed
Other PDB entries of the same protein (UniProt Q9GZT9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6NMQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.