Crystal Structure of the Human vaccinia-related kinase bound to a N,N-dipropynyl-dihydropteridine-3-hydroxyindazole inhibitor. Determined by X-ray diffraction at 2.2 Å resolution. Released 20 Feb 2019.
Explore 6NPN in 3D Show helices and sheets RCSB PDB PDBe
6NPN contains 67 α-helices and 48 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 28-30 | 3 | 1 |
| β-strand | 36-42 | 7 | 1 |
| β-strand | 51-56 | 6 | 1 |
| α-helix | 61-63 | 3 | |
| β-strand | 68-74 | 7 | 1 |
| α-helix | 78-90 | 13 | |
| α-helix | 93-102 | 10 | |
| α-helix | 111-112 | 2 | |
| β-strand | 113-121 | 9 | 1 |
| β-strand | 124-132 | 9 | 1 |
| β-strand | 134-137 | 4 | 2 |
| α-helix | 138-144 | 7 | |
| α-helix | 151-170 | 20 | |
| β-strand | 173-174 | 2 | 3 |
| α-helix | 180-182 | 3 | |
| β-strand | 183-186 | 4 | 2 |
| β-strand | 193-195 | 3 | 2 |
| β-strand | 202-203 | 2 | 3 |
| α-helix | 206-208 | 3 | |
| α-helix | 210-212 | 3 | |
| α-helix | 230-233 | 4 | |
| α-helix | 240-256 | 17 | |
| α-helix | 268-280 | 13 | |
| α-helix | 282-289 | 8 | |
| α-helix | 297-307 | 11 | |
| α-helix | 313-315 | 3 | |
| α-helix | 317-330 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 28-30 | 3 | 4 |
| β-strand | 36-39 | 4 | 4 |
| β-strand | 51-56 | 6 | 4 |
| β-strand | 68-73 | 6 | 4 |
| α-helix | 78-90 | 13 | |
| α-helix | 93-103 | 11 | |
| α-helix | 110-112 | 3 | |
| β-strand | 113-118 | 6 | 4 |
| β-strand | 127-132 | 6 | 4 |
| β-strand | 134-137 | 4 | 5 |
| α-helix | 138-144 | 7 | |
| α-helix | 151-170 | 20 | |
| β-strand | 173-174 | 2 | 6 |
| α-helix | 180-182 | 3 | |
| β-strand | 183-186 | 4 | 5 |
| β-strand | 193-195 | 3 | 5 |
| β-strand | 202-203 | 2 | 6 |
| α-helix | 206-208 | 3 | |
| α-helix | 210-213 | 4 | |
| β-strand | 215 | 1 | 7 |
| α-helix | 217-219 | 3 | |
| α-helix | 230-233 | 4 | |
| β-strand | 236 | 1 | 7 |
| α-helix | 237-238 | 2 | |
| α-helix | 240-256 | 17 | |
| α-helix | 262-264 | 3 | |
| α-helix | 268-280 | 13 | |
| α-helix | 282-289 | 8 | |
| α-helix | 297-307 | 11 | |
| α-helix | 313-315 | 3 | |
| α-helix | 317-330 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 28-30 | 3 | 8 |
| β-strand | 36-42 | 7 | 8 |
| β-strand | 51-56 | 6 | 8 |
| β-strand | 68-74 | 7 | 8 |
| α-helix | 78-90 | 13 | |
| α-helix | 93-102 | 10 | |
| α-helix | 111-112 | 2 | |
| β-strand | 113-121 | 9 | 8 |
| β-strand | 124-132 | 9 | 8 |
| β-strand | 134-137 | 4 | 9 |
| α-helix | 138-144 | 7 | |
| α-helix | 151-170 | 20 | |
| β-strand | 173-174 | 2 | 10 |
| α-helix | 180-182 | 3 | |
| β-strand | 183-186 | 4 | 9 |
| β-strand | 193-195 | 3 | 9 |
| β-strand | 202-203 | 2 | 10 |
| α-helix | 206-208 | 3 | |
| α-helix | 210-212 | 3 | |
| α-helix | 230-233 | 4 | |
| α-helix | 236-238 | 3 | |
| α-helix | 240-256 | 17 | |
| α-helix | 268-280 | 13 | |
| α-helix | 282-289 | 8 | |
| α-helix | 297-307 | 11 | |
| α-helix | 313-315 | 3 | |
| α-helix | 317-330 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 23-24 | 2 | |
| β-strand | 28-30 | 3 | 11 |
| β-strand | 36-42 | 7 | 11 |
| β-strand | 51-56 | 6 | 11 |
| β-strand | 68-74 | 7 | 11 |
| α-helix | 78-90 | 13 | |
| α-helix | 93-102 | 10 | |
| α-helix | 111-112 | 2 | |
| β-strand | 113-121 | 9 | 11 |
| β-strand | 124-132 | 9 | 11 |
| β-strand | 137 | 1 | 12 |
| α-helix | 138-144 | 7 | |
| α-helix | 151-170 | 20 | |
| β-strand | 173-174 | 2 | 13 |
| α-helix | 180-182 | 3 | |
| β-strand | 183-185 | 3 | 12 |
| β-strand | 193-195 | 3 | 12 |
| β-strand | 202-203 | 2 | 13 |
| α-helix | 206-208 | 3 | |
| α-helix | 210-213 | 4 | |
| β-strand | 215 | 1 | 14 |
| α-helix | 230-233 | 4 | |
| β-strand | 236 | 1 | 14 |
| α-helix | 237-238 | 2 | |
| α-helix | 240-256 | 17 | |
| α-helix | 268-280 | 13 | |
| α-helix | 282-289 | 8 | |
| α-helix | 297-307 | 11 | |
| α-helix | 313-315 | 3 | |
| α-helix | 317-330 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein kinase VRK1 | A, B, C, D | protein | 364 | Homo sapiens | Q99986 (AlphaFold model) |
>6NPN_1 Serine/threonine-protein kinase VRK1 (chains A, B, C, D) SMRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAAAAWKVGLPIGQGGFGCIYLADMNSSE SVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHD KNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKA SNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKAYAADPKRCHDGTIEFTSIDAHNGVAPSR RGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPAANAPGEIA KYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRAA EIEE
| ID | Name | Formula | Copies |
|---|---|---|---|
| KWJ | (7R)-7-methyl-2-[(3-oxo-2,3-dihydro-1H-indazol-6-yl)amino]-5,8-di(prop-2-yn-1-y… | C20 H17 N7 O2 | 4 |
Water and common crystallization additives (PEG, EDO, SO4) are not listed.
Crystal Structure of the Human vaccinia-related kinase bound to a N,N-dipropynyl-dihydropteridine-3-hydroxyindazole inhibitor. Counago, R.M., dos Reis, C.V., Takarada, J.E. et al. To be published.
Other PDB entries of the same protein (UniProt Q99986 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6NPN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.