6NYH: Human RIPK1 kinase domain

Structure of human RIPK1 kinase domain in complex with GNE684. Determined by X-ray diffraction at 2.1 Å resolution. Released 29 May 2019.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,295
Mol. weight: 68.85 kDa
Ligands: L8D
Released: 29 May 2019

Explore 6NYH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6NYH contains 32 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	10-12	3	1
α-helix	14-16	3
β-strand	17	1	1
β-strand	31-36	6	1
β-strand	40-49	10	1
α-helix	54-56	3
α-helix	57-68	12
β-strand	75	1	2
β-strand	78-83	6	1
β-strand	87-93	7	1
β-strand	99	1	2
α-helix	100-104	5
α-helix	112-131	20
α-helix	141-143	3
β-strand	144-146	3	2
β-strand	152-154	3	2
α-helix	163-170	8
α-helix	195-197	3
α-helix	204-205	2
α-helix	207-223	17
α-helix	234-242	9
α-helix	249-251	3
α-helix	258-267	10
α-helix	272-274	3
α-helix	278-288	11
α-helix	289-293	5

Chain B: 16 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	14-16	3
β-strand	31-35	5	3
β-strand	41-46	6	3
α-helix	57-68	12
β-strand	75	1	4
β-strand	78-83	6	3
β-strand	88-93	6	3
β-strand	98-99	2	4
α-helix	100-104	5
α-helix	112-131	20
α-helix	141-143	3
β-strand	144-146	3	4
β-strand	152-154	3	4
α-helix	163-168	6
α-helix	195-197	3
α-helix	204-205	2
α-helix	207-223	17
α-helix	234-242	9
α-helix	249-251	3
α-helix	258-267	10
α-helix	272-274	3
α-helix	276-277	2
α-helix	278-288	11
α-helix	289-293	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Receptor-interacting serine/threonine-protein kinase 1	A, B	protein	296	Homo sapiens	Q13546 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6NYH_1 Receptor-interacting serine/threonine-protein kinase 1 (chains A, B)
GSMQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLAFHRTQGLMIMKTVYKGPNCIEHNE
ALLEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRI
ILEIIEGMAYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELRE
VDGTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAIAEQQLI
MAIKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLE

Ligands and cofactors

ID	Name	Formula	Copies
L8D	(5S)-N-[(3S)-7-methoxy-1-methyl-2-oxo-2,3,4,5-tetrahydro-1H-pyrido[3,4-b]azepin…	C23 H24 N6 O3	2

Water and common crystallization additives (IOD) are not listed.

Primary citation

RIP1 inhibition blocks inflammatory diseases but not tumor growth or metastases. Patel, S., Webster, J.D., Varfolomeev, E. et al. Cell Death Differ (2020) 27:161-175. DOI 10.1038/s41418-019-0347-0 · PubMed

Other PDB entries of the same protein (UniProt Q13546 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5ZMZ 1.4 Å, Amyloid core of RIP1
6AC5 1.45 Å, Crystal structure of RIPK1 death domain GlcNAcylated by EPEC effector NleB
4ITJ 1.8 Å, Crystal structure of RIP1 kinase in complex with necrostatin-4
6NW2 2.0 Å, Structure of human RIPK1 kinase domain in complex with compound 11
7FD0 2.0 Å, Crystal Structure of human RIPK1 kinase domain in complex with a novel inhibitor
24IB 2.05 Å, Crystal structure of human RIPK1 kinase domain in complex with compound HR10
9Q31 2.05 Å, RIP1 kinase domain in complex with GDC-8264
9GTY 2.15 Å, RIPK1 in complex with AZ"320
7FCZ 2.21 Å, Crystal Structure of human RIPK1 kinase domain in complex with a novel inhibitor
5HX6 2.23 Å, Crystal structure of RIP1 kinase with a benzo[b][1,4]oxazepin-4-one
4ITH 2.25 Å, Crystal structure of RIP1 kinase in complex with necrostatin-1 analog
9GTG 2.25 Å, RIPK1 in complex with AZ"902

Browse structure collections

About this viewer

MolViewer shows 6NYH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.