Munc13-1 C2B-domain, calcium bound. Determined by X-ray diffraction at 1.37 Å resolution. Released 20 Feb 2019.
Explore 6NYT in 3D Show helices and sheets RCSB PDB PDBe
6NYT contains 6 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 689-699 | 11 | 1 |
| α-helix | 701-703 | 3 | |
| β-strand | 712-718 | 7 | 2 |
| β-strand | 721-724 | 4 | 2 |
| α-helix | 725-729 | 5 | |
| β-strand | 735-744 | 10 | 1 |
| β-strand | 750-757 | 8 | 2 |
| α-helix | 762 | 1 | |
| α-helix | 763-767 | 5 | |
| β-strand | 776-784 | 9 | 2 |
| α-helix | 785-787 | 3 | |
| β-strand | 791-797 | 7 | 1 |
| α-helix | 798 | 1 | |
| β-strand | 799 | 1 | 2 |
| β-strand | 810-818 | 9 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein unc-13 homolog A | A | protein | 148 | Rattus norvegicus | Q62768 (AlphaFold model) |
>6NYT_1 Protein unc-13 homolog A (chains A) EFAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIYGNL NPVWEENFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRESDDFLGQTIIEVRTLSGEM DVWYNLDKRTDKSAVSGAIRLHISVEIK
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 2 |
Water and common crystallization additives (GOL, CL) are not listed.
Munc13 C2B domain is an activity-dependent Ca2+ regulator of synaptic exocytosis. Shin, O.H., Lu, J., Rhee, J.S. et al. Nat Struct Mol Biol (2010) 17:280-288. DOI 10.1038/nsmb.1758 · PubMed
Other PDB entries of the same protein (UniProt Q62768 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6NYT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.