The crystal structure of human MORC3 ATPase-CW in complex with AMPPNP. Determined by X-ray diffraction at 2.41 Å resolution. Released 20 Mar 2019.
Explore 6O1E in 3D Show helices and sheets RCSB PDB PDBe
6O1E contains 19 α-helices and 25 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-13 | 4 | |
| α-helix | 17-23 | 7 | |
| α-helix | 29-41 | 13 | |
| β-strand | 49-57 | 9 | 1 |
| β-strand | 60-67 | 8 | 1 |
| α-helix | 74-80 | 7 | |
| β-strand | 91 | 1 | 2 |
| β-strand | 94 | 1 | 2 |
| α-helix | 103-111 | 9 | |
| β-strand | 112-121 | 10 | 1 |
| β-strand | 125-131 | 7 | 1 |
| α-helix | 132-137 | 6 | |
| β-strand | 147-150 | 4 | 1 |
| α-helix | 159-172 | 14 | |
| α-helix | 178-187 | 10 | |
| β-strand | 192-201 | 10 | 1 |
| β-strand | 203 | 1 | 3 |
| β-strand | 208 | 1 | 3 |
| β-strand | 211 | 1 | 4 |
| β-strand | 220 | 1 | 4 |
| α-helix | 243-245 | 3 | |
| α-helix | 246-248 | 3 | |
| β-strand | 250 | 1 | 4 |
| α-helix | 251-257 | 7 | |
| β-strand | 259 | 1 | 5 |
| β-strand | 265-268 | 4 | 1 |
| β-strand | 271-272 | 2 | 1 |
| α-helix | 278-280 | 3 | |
| β-strand | 283-290 | 8 | 5 |
| β-strand | 299-305 | 7 | 5 |
| β-strand | 314-319 | 6 | 5 |
| β-strand | 322-328 | 7 | 5 |
| α-helix | 332-335 | 4 | |
| β-strand | 343-348 | 6 | 5 |
| β-strand | 354-355 | 2 | 6 |
| β-strand | 360-361 | 2 | 6 |
| α-helix | 365-389 | 25 | |
| α-helix | 399-401 | 3 | |
| β-strand | 409-412 | 4 | 7 |
| β-strand | 419-422 | 4 | 7 |
| α-helix | 423 | 1 | |
| α-helix | 435-437 | 3 | |
| α-helix | 441-443 | 3 | |
| α-helix | 449-452 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| MORC family CW-type zinc finger protein 3 | A | protein | 455 | Homo sapiens | Q14149 (AlphaFold model) |
>6O1E_1 MORC family CW-type zinc finger protein 3 (chains A) MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDH ICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTK NGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQK LLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERM DQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVYRPKFLSKTVR ITFGFNCRNKDHYGIMMYHRNRLIKAYEKVGCQLRANNMGVGVVGIIECNFLKPTHNKQD FDYTNEYRLTITALGEKLNDYWNEMKVKKNTEYPLNLPVEDIQKRPDQTWVQCDACLKWR KLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPEDE
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
| MG | Magnesium ion | Mg | 1 |
| ANP | Phosphoaminophosphonic acid-adenylate ester | C10 H17 N6 O12 P3 | 1 |
Mechanism for autoinhibition and activation of the MORC3 ATPase. Zhang, Y., Klein, B.J., Cox, K.L. et al. Proc Natl Acad Sci U S A (2019) 116:6111-6119. DOI 10.1073/pnas.1819524116 · PubMed
Other PDB entries of the same protein (UniProt Q14149 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6O1E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.