Full length human plasma kallikrein with inhibitor. Determined by X-ray diffraction at 2.2 Å resolution. Released 6 Mar 2019.
Explore 6O1G in 3D Show helices and sheets RCSB PDB PDBe
6O1G contains 17 α-helices and 47 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 25-26 | 2 | 1 |
| β-strand | 29-31 | 3 | 2 |
| β-strand | 35-40 | 6 | 1 |
| α-helix | 44-53 | 10 | |
| β-strand | 59-63 | 5 | 1 |
| α-helix | 71-73 | 3 | |
| β-strand | 76-80 | 5 | 1 |
| β-strand | 89-91 | 3 | 2 |
| β-strand | 96-99 | 4 | 1 |
| α-helix | 105-107 | 3 | |
| β-strand | 115-122 | 8 | 3 |
| β-strand | 124-130 | 7 | 3 |
| α-helix | 134-143 | 10 | |
| β-strand | 149-153 | 5 | 3 |
| β-strand | 165-170 | 6 | 3 |
| α-helix | 172-174 | 3 | |
| β-strand | 178-189 | 12 | 3 |
| α-helix | 192-194 | 3 | |
| β-strand | 206-210 | 5 | 4 |
| β-strand | 214-220 | 7 | 4 |
| α-helix | 224-233 | 10 | |
| β-strand | 239-243 | 5 | 4 |
| α-helix | 250-252 | 3 | |
| β-strand | 255-260 | 6 | 4 |
| β-strand | 270-279 | 10 | 4 |
| β-strand | 297-298 | 2 | 5 |
| β-strand | 301-303 | 3 | 6 |
| β-strand | 305-312 | 8 | 5 |
| α-helix | 315-324 | 10 | |
| β-strand | 330-334 | 5 | 5 |
| α-helix | 337-339 | 3 | |
| β-strand | 340 | 1 | 5 |
| β-strand | 345-351 | 7 | 5 |
| β-strand | 359-361 | 3 | 6 |
| β-strand | 366-370 | 5 | 5 |
| β-strand | 392 | 1 | 7 |
| β-strand | 395-396 | 2 | 8 |
| β-strand | 405-411 | 7 | 9 |
| β-strand | 415-425 | 11 | 9 |
| β-strand | 428-431 | 4 | 9 |
| α-helix | 433-436 | 4 | |
| β-strand | 445-449 | 5 | 9 |
| β-strand | 453 | 1 | 10 |
| α-helix | 454-456 | 3 | |
| β-strand | 464 | 1 | 9 |
| β-strand | 466-471 | 6 | 9 |
| β-strand | 485-489 | 5 | 9 |
| α-helix | 492-495 | 4 | |
| β-strand | 496 | 1 | 11 |
| β-strand | 499 | 1 | 11 |
| α-helix | 501-502 | 2 | |
| β-strand | 503 | 1 | 8 |
| β-strand | 517-521 | 5 | 8 |
| β-strand | 534 | 1 | 10 |
| β-strand | 536-539 | 4 | 8 |
| β-strand | 542 | 1 | 8 |
| α-helix | 545-550 | 6 | |
| β-strand | 561-564 | 4 | 8 |
| β-strand | 572 | 1 | 7 |
| β-strand | 581-586 | 6 | 8 |
| β-strand | 589-598 | 10 | 8 |
| β-strand | 609-613 | 5 | 8 |
| α-helix | 614-617 | 4 | |
| α-helix | 618-625 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Plasma kallikrein | A | protein | 638 | Homo sapiens | P03952 (AlphaFold model) |
>6O1G_1 Plasma kallikrein (chains A) MILFKQATYFISLFATVSCGCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLF SFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVD MRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIK VLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFF TFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGV DFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRI AYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCG GSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEG NHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNI PLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGE GCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPA
| ID | Name | Formula | Copies |
|---|---|---|---|
| 7SD | N-[(6-amino-2,4-dimethylpyridin-3-yl)methyl]-1-({4-[(1H-pyrazol-1-yl)methyl]phe… | C23 H25 N7 O | 1 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
Structures of full-length plasma kallikrein bound to highly specific inhibitors describe a new mode of targeted inhibition. Partridge, J.R., Choy, R.M., Silva-Garcia, A. et al. J Struct Biol (2019) 206:170-182. DOI 10.1016/j.jsb.2019.03.001 · PubMed
Other PDB entries of the same protein (UniProt P03952 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6O1G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.