Crystal structure of MORC3 CW domain fused with viral influenza A NS1 peptide. Determined by X-ray diffraction at 1.41 Å resolution. Released 8 May 2019.
Explore 6O5W in 3D Show helices and sheets RCSB PDB PDBe
6O5W contains 4 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 228-230 | 3 | 1 |
| β-strand | 409-412 | 4 | 1 |
| β-strand | 419-421 | 3 | 1 |
| α-helix | 422-423 | 2 | |
| α-helix | 435-437 | 3 | |
| α-helix | 441-443 | 3 | |
| α-helix | 449-452 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| NS1-linked peptide,MORC family CW-type zinc finger protein 3 | A | protein | 59 | Homo sapiens | Q14149 (AlphaFold model) |
>6O5W_1 NS1-linked peptide,MORC family CW-type zinc finger protein 3 (chains A) TARSKVGGSGDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPEDE
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
MORC3 Is a Target of the Influenza A Viral Protein NS1. Zhang, Y., Ahn, J., Green, K.J. et al. Structure (2019) 27:1029-1033.e3. DOI 10.1016/j.str.2019.03.015 · PubMed
Other PDB entries of the same protein (UniProt Q14149 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6O5W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.