Horse liver L57F alcohol dehydrogenase E complexed with NAD and trifluoroethanol. Determined by X-ray diffraction at 1.1 Å resolution. Released 3 Apr 2019.
Explore 6OA7 in 3D Show helices and sheets RCSB PDB PDBe
6OA7 contains 44 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-13 | 7 | 1 |
| β-strand | 14 | 1 | 2 |
| β-strand | 22-28 | 7 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 35-44 | 10 | 3 |
| α-helix | 47-54 | 8 | |
| β-strand | 63 | 1 | 2 |
| β-strand | 69-76 | 8 | 3 |
| β-strand | 88-91 | 4 | 3 |
| α-helix | 101-104 | 4 | |
| β-strand | 130-132 | 3 | 1 |
| β-strand | 135-137 | 3 | 1 |
| β-strand | 138 | 1 | 2 |
| β-strand | 147 | 1 | 1 |
| β-strand | 149-153 | 5 | 3 |
| α-helix | 154-156 | 3 | |
| β-strand | 157-159 | 3 | 3 |
| α-helix | 166-169 | 4 | |
| α-helix | 170-173 | 4 | |
| α-helix | 175-181 | 7 | |
| α-helix | 182-187 | 6 | |
| α-helix | 189-190 | 2 | |
| β-strand | 194-198 | 5 | 4 |
| α-helix | 202-213 | 12 | |
| β-strand | 218-222 | 5 | 4 |
| α-helix | 226-228 | 3 | |
| α-helix | 229-235 | 7 | |
| β-strand | 239-241 | 3 | 4 |
| α-helix | 243-245 | 3 | |
| α-helix | 250-257 | 8 | |
| β-strand | 262 | 1 | 5 |
| β-strand | 264-267 | 4 | 4 |
| α-helix | 272-281 | 10 | |
| β-strand | 282 | 1 | 5 |
| β-strand | 288-291 | 4 | 4 |
| α-helix | 299-300 | 2 | |
| β-strand | 301-303 | 3 | 6 |
| α-helix | 306-309 | 4 | |
| β-strand | 313-316 | 4 | 4 |
| α-helix | 319-321 | 3 | |
| α-helix | 324-336 | 13 | |
| α-helix | 343-345 | 3 | |
| β-strand | 346-351 | 6 | 3 |
| α-helix | 352-354 | 3 | |
| α-helix | 355-363 | 9 | |
| β-strand | 369-373 | 5 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6 | 1 | |
| β-strand | 7-13 | 7 | 7 |
| β-strand | 14 | 1 | 8 |
| β-strand | 22-28 | 7 | 7 |
| α-helix | 29-31 | 3 | |
| β-strand | 35-44 | 10 | 9 |
| α-helix | 47-54 | 8 | |
| β-strand | 63 | 1 | 8 |
| β-strand | 68-76 | 9 | 9 |
| β-strand | 88-91 | 4 | 9 |
| α-helix | 101-104 | 4 | |
| β-strand | 130-132 | 3 | 7 |
| β-strand | 135-137 | 3 | 7 |
| β-strand | 138 | 1 | 8 |
| β-strand | 147 | 1 | 7 |
| β-strand | 149-153 | 5 | 9 |
| α-helix | 154-156 | 3 | |
| β-strand | 157-159 | 3 | 9 |
| α-helix | 166-169 | 4 | |
| α-helix | 170-173 | 4 | |
| α-helix | 175-181 | 7 | |
| α-helix | 182-187 | 6 | |
| β-strand | 194-198 | 5 | 4 |
| α-helix | 202-213 | 12 | |
| β-strand | 218-222 | 5 | 4 |
| α-helix | 226-228 | 3 | |
| α-helix | 229-235 | 7 | |
| β-strand | 239-241 | 3 | 4 |
| α-helix | 243-245 | 3 | |
| α-helix | 250-257 | 8 | |
| β-strand | 262 | 1 | 10 |
| β-strand | 264-267 | 4 | 4 |
| α-helix | 272-281 | 10 | |
| β-strand | 282 | 1 | 10 |
| β-strand | 288-291 | 4 | 4 |
| α-helix | 299-300 | 2 | |
| β-strand | 301-303 | 3 | 6 |
| α-helix | 306-309 | 4 | |
| β-strand | 313-316 | 4 | 4 |
| α-helix | 319-321 | 3 | |
| α-helix | 324-336 | 13 | |
| α-helix | 343-345 | 3 | |
| β-strand | 346-351 | 6 | 9 |
| α-helix | 352-354 | 3 | |
| α-helix | 355-363 | 9 | |
| β-strand | 369-373 | 5 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Alcohol dehydrogenase E chain | A, B | protein | 374 | Equus caballus | P00327 (AlphaFold model) |
>6OA7_1 Alcohol dehydrogenase E chain (chains A, B) STAGKVIKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTFVTP LPVIAGHEAAGIVESIGEGVTTVRPGDKVIPLFTPQCGKCRVCKHPEGNFCLKNDLSMPR GTMQDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGY GSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATEC VNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGVSVIVGVPPDSQN LSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFD LLRSGESIRTILTF
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 4 |
| NAJ | Nicotinamide-adenine-dinucleotide (acidic form) | C21 H27 N7 O14 P2 | 2 |
| ETF | Trifluoroethanol | C2 H3 F3 O | 2 |
| MRD | (4R)-2-methylpentane-2,4-diol | C6 H14 O2 | 5 |
Substitutions of Amino Acid Residues in the Substrate Binding Site of Horse Liver Alcohol Dehydrogenase Have Small Effects on the Structures but Significantly Affect Catalysis of Hydrogen Transfer. Kim, K., Plapp, B.V. Biochemistry (2020) 59:862-879. DOI 10.1021/acs.biochem.9b01074 · PubMed
Other PDB entries of the same protein (UniProt P00327 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6OA7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.