6OIM: Human KRAS G12C covalently

Crystal Structure of human KRAS G12C covalently bound to AMG 510. Determined by X-ray diffraction at 1.65 Å resolution. Released 6 Nov 2019.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,613
Mol. weight: 22.07 kDa
Ligands: MG, MOV, GDP
Released: 6 Nov 2019

Explore 6OIM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6OIM contains 6 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	1-9	9	1
α-helix	16-25	10
β-strand	38-46	9	1
β-strand	49-57	9	1
α-helix	66-73	8
β-strand	77-83	7	1
α-helix	87-91	5
α-helix	93-103	11
β-strand	111-116	6	1
α-helix	127-137	11
β-strand	141-143	3	1
α-helix	152-168	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GTPase KRas	A	protein	183	Homo sapiens	P01116 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6OIM_1 GTPase KRas (chains A)
MKHHHHHHHDEVDGMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVI
DGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQIKRVKDS
EDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKH
KEK

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
MOV	AMG 510 (bound form)	C30 H32 F2 N6 O3	1
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1

Primary citation

The clinical KRAS(G12C) inhibitor AMG 510 drives anti-tumour immunity. Canon, J., Rex, K., Saiki, A.Y. et al. Nature (2019) 575:217-223. DOI 10.1038/s41586-019-1694-1 · PubMed

Other PDB entries of the same protein (UniProt P01116 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9IAY 0.95 Å, Structure of 10 in complex with GDP-KRAS
9IAW 1.0 Å, Structure of 5 in complex with GDP-KRAS
12XE 1.01 Å, Crystal structure of KRAS(Q61K) bound to GppNHp and ligand
8ONV 1.01 Å, KRAS-G13D in complex with BI-2493
6P0Z 1.01 Å, Crystal structure of N-acetylated KRAS (2-169) bound to GDP and Mg
9IB5 1.01 Å, Structure of 18 (BI-2493) in complex with GDP-KRAS
8AZZ 1.02 Å, KRAS-G12V in complex with BI-2865
8AZX 1.04 Å, KRAS-G12C in complex with BI-2865
8B00 1.04 Å, KRAS-G13D in complex with BI-2865
8TVK 1.04 Å, KRAS 1-169 G12C Mutant at 100k
4QL3 1.04 Å, Crystal Structure of a GDP-bound G12R Oncogenic Mutant of Human GTPase KRas
8AZV 1.05 Å, KRAS in complex with BI-2865

Browse more

6OIM is part of these collections:

Kinases and cancer drug targets

About this viewer

MolViewer shows 6OIM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.