6OQY: Human LRH-1

Human LRH-1 bound to the agonist 6N and a fragment of the Tif2 coregulator. Determined by X-ray diffraction at 2.23 Å resolution. Released 28 Aug 2019.

Method: X-ray diffraction
Resolution: 2.23 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,079
Mol. weight: 30.61 kDa
Ligands: N2J
Released: 28 Aug 2019

Explore 6OQY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6OQY contains 13 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	303-309	7
α-helix	315-331	17
α-helix	341-361	21
α-helix	366-368	3
α-helix	371-397	27
β-strand	402-404	3	1
β-strand	410-412	3	1
α-helix	413-420	8
α-helix	422-440	19
α-helix	445-456	12
α-helix	467-488	22
α-helix	495-500	6
α-helix	502-523	22
α-helix	531-537	7

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	743-750	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear receptor subfamily 5 group A member 2	A	protein	245	Homo sapiens	O00482 (AlphaFold model)
Nuclear receptor coactivator 2	C	protein	15	Homo sapiens	Q15596 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6OQY_1 Nuclear receptor subfamily 5 group A member 2 (chains A)
SNASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSI
VEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSII
ASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQ
VNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEML
HAKRA

Sequence of entity 2 (C), FASTA

>6OQY_2 Nuclear receptor coactivator 2 (chains C)
KENALLRYLLDKDDT

Ligands and cofactors

ID	Name	Formula	Copies
N2J	N-[(1S,3aR,6aR)-5-hexyl-4-phenyl-3a-(1-phenylethenyl)-1,2,3,3a,6,6a-hexahydrope…	C28 H36 N2 O2 S	1

Primary citation

Development of the First Low Nanomolar Liver Receptor Homolog-1 Agonist through Structure-guided Design. Mays, S.G., Flynn, A.R., Cornelison, J.L. et al. J Med Chem (2019) 62:11022-11034. DOI 10.1021/acs.jmedchem.9b00753 · PubMed

Other PDB entries of the same protein (UniProt O00482 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6VC2 1.7 Å, LRH-1 bound to SS-RJW100 and a fragment of the Tif2 Coactivator
3PLZ 1.75 Å, Human LRH1 LBD bound to GR470
4PLD 1.75 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, in its apo State Bound to a…
4PLE 1.75 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, Bound to an E. Coli…
4ONI 1.8 Å, Structure of Human Orphan Receptor LRH1 bound to two bacterial phospholipids
5L11 1.85 Å, Human Liver Receptor Homologue-1 (LRH-1) Bound to RJW100 and a Fragment of TIF-2
4RWV 1.86 Å, Crystal structure of PIP3 bound human nuclear receptor LRH-1 (Liver Receptor Homolog 1,…
1YUC 1.9 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, Bound to Phospholipid and a…
4DOR 1.9 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, in its apo State Bound to a…
5SYZ 1.93 Å, Human Liver Receptor Homologue-1 (LRH-1) Bound to a RJW100 stereoisomer and a Fragment…
5UNJ 1.96 Å, Structure of Human Liver Receptor Homolog 1 in complex with PGC1a and RJW100
4DOS 2.0 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, Bound to DLPC and a Fragment…

Browse structure collections

About this viewer

MolViewer shows 6OQY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.