HCV NS3/4A protease domain of genotype 1a in complex with glecaprevir. Determined by X-ray diffraction at 1.73 Å resolution. Released 10 Jun 2020.
Explore 6P6L in 3D Show helices and sheets RCSB PDB PDBe
6P6L contains 11 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 983-985 | 3 | |
| β-strand | 992 | 1 | 1 |
| β-strand | 993-999 | 7 | 2 |
| β-strand | 1006-1009 | 4 | 2 |
| α-helix | 1013-1022 | 10 | |
| β-strand | 1024 | 1 | 3 |
| α-helix | 1028-1029 | 2 | |
| β-strand | 1031 | 1 | 4 |
| β-strand | 1033-1037 | 5 | 2 |
| β-strand | 1042-1048 | 7 | 2 |
| β-strand | 1051-1055 | 5 | 2 |
| α-helix | 1056-1059 | 4 | |
| β-strand | 1064 | 1 | 1 |
| β-strand | 1066 | 1 | 3 |
| β-strand | 1071 | 1 | 1 |
| β-strand | 1075-1077 | 3 | 2 |
| α-helix | 1078-1080 | 3 | |
| β-strand | 1082-1086 | 5 | 2 |
| α-helix | 1087-1088 | 2 | |
| β-strand | 1091 | 1 | 4 |
| β-strand | 1094 | 1 | 2 |
| α-helix | 1095 | 1 | |
| β-strand | 1096 | 1 | 5 |
| α-helix | 1097 | 1 | |
| β-strand | 1103-1107 | 5 | 5 |
| β-strand | 1113-1118 | 6 | 5 |
| β-strand | 1123-1131 | 9 | 5 |
| α-helix | 1132-1135 | 4 | |
| α-helix | 1141 | 1 | |
| β-strand | 1142-1144 | 3 | 5 |
| β-strand | 1150-1160 | 11 | 5 |
| β-strand | 1163-1171 | 9 | 5 |
| α-helix | 1172-1178 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Non-structural protein 4A,Serine protease NS3 | A | protein | 203 | Hepatitis C virus genotype 1a (isolate 1) | P26664 (AlphaFold model) |
>6P6L_1 Non-structural protein 4A,Serine protease NS3 (chains A) GSHMASMKKKGSVVIVGRINLSGDTAYAQQTRGEEGCQETSQTGRDKNQVEGEVQIVSTA TQTFLATSINGVLWTVYHGAGTRTIASPKGPVTQMYTNVDKDLVGWQAPQGSRSLTPCTC GSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGIFRAAVS TRGVAKAVDFIPVESLETTMRSP
Water and common crystallization additives (SO4, EDO) are not listed.
HCV NS3/4A protease domain of genotype 1a in complex with glecaprevir. Timm, J., Kosovrasti, K., Henes, M. et al. To be published.
Other PDB entries of the same protein (UniProt P26664 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6P6L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.