6PA7: Human DNMT3A2-DNMT3B3 complex
The cryo-EM structure of the human DNMT3A2-DNMT3B3 complex bound to nucleosome. Determined by electron microscopy at 2.94 Å resolution. Released 17 Jun 2020.
- Method
- Electron microscopy
- Resolution
- 2.94 Å
- Organisms
- Xenopus laevis, synthetic construct, Homo sapiens
- Chains
- 14
- Atoms
- 21,019
- Mol. weight
- 541.07 kDa
- Ligands
- SAH
- Released
- 17 Jun 2020
Explore 6PA7 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6PA7 contains 94 α-helices and 60 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A and E: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 43-56 | 14 | |
| α-helix | 64-76 | 13 | |
| β-strand | 83-84 | 2 | 1 |
| α-helix | 86-113 | 28 | |
| β-strand | 118-119 | 2 | 2 |
| α-helix | 121-131 | 11 | |
Chain B: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 26-28 | 3 | |
| α-helix | 31-40 | 10 | |
| β-strand | 45-46 | 2 | 2 |
| α-helix | 50-75 | 26 | |
| β-strand | 80-81 | 2 | 1 |
| α-helix | 83-92 | 10 | |
| β-strand | 96-98 | 3 | 3 |
Chains C and G: 5 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-20 | 4 | |
| α-helix | 27-36 | 10 | |
| β-strand | 42-43 | 2 | 4 |
| α-helix | 46-72 | 27 | |
| β-strand | 77-78 | 2 | 5 |
| α-helix | 80-88 | 9 | |
| α-helix | 91-96 | 6 | |
| β-strand | 100-102 | 3 | 6 |
Chain D: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 35-45 | 11 | |
| β-strand | 50-51 | 2 | 5 |
| α-helix | 53-80 | 28 | |
| β-strand | 85-86 | 2 | 4 |
| α-helix | 88-98 | 11 | |
| α-helix | 102-119 | 18 | |
Chain F: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 25-28 | 4 | |
| α-helix | 31-40 | 10 | |
| β-strand | 45-46 | 2 | 8 |
| α-helix | 50-75 | 26 | |
| β-strand | 80-81 | 2 | 7 |
| α-helix | 83-92 | 10 | |
| β-strand | 96-98 | 3 | 6 |
Chain H: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 35-43 | 9 | |
| β-strand | 50-51 | 2 | 10 |
| α-helix | 53-80 | 28 | |
| β-strand | 85-86 | 2 | 9 |
| α-helix | 88-98 | 11 | |
| α-helix | 102-119 | 18 | |
Chains K and P: 17 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 619-626 | 8 | |
| α-helix | 628-630 | 3 | |
| β-strand | 634-638 | 5 | 11 |
| α-helix | 645-652 | 8 | |
| β-strand | 657-663 | 7 | 11 |
| α-helix | 667-677 | 11 | |
| β-strand | 681-684 | 4 | 11 |
| α-helix | 687-689 | 3 | |
| α-helix | 692-697 | 6 | |
| β-strand | 703-707 | 5 | 11 |
| α-helix | 730-741 | 12 | |
| β-strand | 752-758 | 7 | 11 |
| α-helix | 763-773 | 11 | |
| α-helix | 776-777 | 2 | |
| β-strand | 778-781 | 4 | 11 |
| α-helix | 782-784 | 3 | |
| β-strand | 788-789 | 2 | 12 |
| β-strand | 791-796 | 6 | 11 |
| β-strand | 823-825 | 3 | 13 |
| β-strand | 830-831 | 2 | 12 |
| β-strand | 850-852 | 3 | 13 |
| β-strand | 856-857 | 2 | 13 |
| α-helix | 858-860 | 3 | |
| α-helix | 861-867 | 7 | |
| α-helix | 870-871 | 2 | |
| α-helix | 882-891 | 10 | |
| α-helix | 893-894 | 2 | |
| α-helix | 895-902 | 8 | |
| α-helix | 903-907 | 5 | |
Chain N: 13 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 545-548 | 4 | |
| α-helix | 554 | 1 | |
| β-strand | 555-556 | 2 | 14 |
| β-strand | 557-560 | 4 | 15 |
| α-helix | 566-572 | 7 | |
| β-strand | 578-580 | 3 | 14 |
| β-strand | 582-583 | 2 | 16 |
| α-helix | 589-597 | 9 | |
| β-strand | 603-604 | 2 | 16 |
| α-helix | 608-610 | 3 | |
| α-helix | 613-618 | 6 | |
| β-strand | 624-627 | 4 | 15 |
| α-helix | 648-662 | 15 | |
| β-strand | 673-678 | 6 | 15 |
| α-helix | 684-694 | 11 | |
| β-strand | 699-702 | 4 | 15 |
| β-strand | 712-717 | 6 | 15 |
| α-helix | 731-734 | 4 | |
| α-helix | 741-743 | 3 | |
| α-helix | 744-748 | 5 | |
| α-helix | 756-759 | 4 | |
| α-helix | 761-763 | 3 | |
1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Histone H3.2 | A, E | protein | 135 | Xenopus laevis | P84233 (AlphaFold model) |
| Histone H4 | B, F | protein | 103 | Xenopus laevis | P62799 (AlphaFold model) |
| Histone H2A type 1 | C, G | protein | 129 | Xenopus laevis | P06897 (AlphaFold model) |
| Histone H2B 1.1 | D, H | protein | 123 | Xenopus laevis | P02281 (AlphaFold model) |
| DNA (167-mer) | I | DNA | 167 | synthetic construct | |
| DNA (167-mer) | J | DNA | 167 | synthetic construct | |
| DNA (cytosine-5)-methyltransferase 3A | K, P | protein | 689 | Homo sapiens | Q9Y6K1 |
| DNA (cytosine-5)-methyltransferase 3B | N, S | protein | 770 | Homo sapiens | Q9UBC3 |
Sequence of entity 1 (A, E), FASTA
>6PA7_1 Histone H3.2 (chains A, E)
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL
LIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIM
PKDIQLARRIRGERA
Sequence of entity 2 (B, F), FASTA
>6PA7_2 Histone H4 (chains B, F)
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sequence of entity 3 (C, G), FASTA
>6PA7_3 Histone H2A type 1 (chains C, G)
SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
ESSKSAKSK
Sequence of entity 4 (D, H), FASTA
>6PA7_4 Histone H2B 1.1 (chains D, H)
MAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIM
NSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SAK
Sequence of entity 5 (I), FASTA
>6PA7_5 DNA (167-MER) (chains I)
ATCGGCCGCCCTGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAG
CACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCC
CTAGTCTCCAGGCACGTGTCAGATATATACATCCTGTGGCGGCCGAT
Sequence of entity 6 (J), FASTA
>6PA7_6 DNA (167-MER) (chains J)
ATCGGCCGCCACAGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCT
TGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTA
CGACCAATTGAGCGGCCTCGGCACCGGGATTCTCCAGGGCGGCCGAT
Sequence of entity 7 (K, P), FASTA
>6PA7_7 DNA (cytosine-5)-methyltransferase 3A (chains K, P)
MNAVEENQGPGESQKVEEASPPAVQQPTDPASPTVATTPEPVGSDAGDKNATKAGDDEPE
YEDGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEK
LMPLSSFCSAFHQATYNKQPMYRKAIYEVLQVASSRAGKLFPVCHDSDESDTAKAVEVQN
KPMIEWALGGFQPSGPKGLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTAE
KPKVKEIIDERTRERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLE
CAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNC
YMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGI
ATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDL
VIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGV
SDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGR
IAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRL
ARQRLLGRSWSVPVIRHLFAPLKEYFACV
Sequence of entity 8 (N, S), FASTA
>6PA7_8 DNA (cytosine-5)-methyltransferase 3B (chains N, S)
MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREV
SSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRETRTRSESPAVRTRNNNSVSSRERHRPS
PRSTRGRQGRNHVDESPVEFPATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGT
PQSSSTPYARLAQDSQQGGMESPQVEADSGDGDSSEYQDGKEFGIGDLVWGKIKGFSWWP
AMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRK
AMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKPNNTQPENKTR
RRTADDSATSDYCPAPKRLKTNCYNNGKDRGDEDQSREQMASDVANNKSSLEDGCLSCGR
KNPVSFHPLFEGGLCQTCRDRFLELFYMYDDDGYQSYCTVCCEGRELLLCSNTSCCRCFC
VECLEVLVGTGTAAEAKLQEPWSCYMCLPQRCHGVLRRRKDWNVRLQAFFTSDTGLEYEA
PKLYPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKVGKYVASEVCEESIAVGTVKHEG
NIKYVNDVRNITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLN
YSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLECNPVMIDAIKVSAAHRARYFWGNLP
GMNRIFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| SAH | S-adenosyl-L-homocysteine | C14 H20 N6 O5 S | 2 |
Water and common crystallization additives (CL) are not listed.
Primary citation
Structure of nucleosome-bound DNA methyltransferases DNMT3A and DNMT3B. Xu, T.H., Liu, M., Zhou, X.E. et al. Nature (2020) 586:151-155. DOI 10.1038/s41586-020-2747-1 · PubMed
Other PDB entries of the same protein (UniProt P84233 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 2HUE 1.7 Å, Structure of the H3-H4 chaperone Asf1 bound to histones H3 and H4
- 3GV6 1.76 Å, Crystal Structure of human chromobox homolog 6 (CBX6) with H3K9 peptide
- 1KX5 1.94 Å, X-Ray Structure of the Nucleosome Core Particle, NCP147, at 1.9 A Resolution
- 1KX3 2.0 Å, X-Ray Structure of the Nucleosome Core Particle, NCP146, at 2.0 A Resolution
- 4QEO 2.0 Å, crystal structure of KRYPTONITE in complex with mCHH DNA, H3(1-15) peptide and SAH
- 1S32 2.05 Å, Molecular Recognition of the Nucleosomal 'Supergroove'
- 3UTA 2.07 Å, Crystal Structure of Nucleosome Core Particle Assembled with an Alpha-Satellite Sequence…
- 3C1B 2.2 Å, The effect of H3 K79 dimethylation and H4 K20 trimethylation on nucleosome and chromatin…
- 3UT9 2.2 Å, Crystal Structure of Nucleosome Core Particle Assembled with a Palindromic Widom '601'…
- 3UTB 2.2 Å, Crystal Structure of Nucleosome Core Particle Assembled with the 146b Alpha-Satellite…
- 6WZ5 2.2 Å, Bridging of double-strand DNA break activates PARP2/HPF1 to modify chromatin
- 8RUQ 2.29 Å, Borealin N-terminus in complex with H3.T3p-nucleosome
Browse structure collections
About this viewer
MolViewer shows 6PA7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.