6PGU: Histone acetyltransferase p300

Crystal structure of the p300 acetyltransferase domain with allosteric inhibitor CPI-076 and CoA. Determined by X-ray diffraction at 1.72 Å resolution. Released 23 Oct 2019.

Method: X-ray diffraction
Resolution: 1.72 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,754
Mol. weight: 76.19 kDa
Ligands: OK7, COA
Released: 23 Oct 2019

Explore 6PGU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6PGU contains 42 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	1294-1295	2
α-helix	1297-1313	17
β-strand	1321-1334	14	1
α-helix	1335-1336	2
α-helix	1337-1339	3
α-helix	1340-1344	5
β-strand	1352-1366	15	1
β-strand	1369-1381	13	1
α-helix	1386	1
β-strand	1392-1400	9	1
α-helix	1407-1409	3
α-helix	1410-1428	19
β-strand	1432-1436	5	1
α-helix	1439-1441	3
α-helix	1460-1476	17
β-strand	1482-1485	4	1
α-helix	1486-1493	8
α-helix	1498-1500	3
α-helix	1508-1516	9
α-helix	1583-1590	8
α-helix	1592-1594	3
β-strand	1595-1599	5	1
α-helix	1603-1606	4
α-helix	1609-1612	4
α-helix	1617-1618	2
β-strand	1619	1	1
α-helix	1622-1624	3
α-helix	1628-1637	10
α-helix	1644-1660	17

Chain B: 21 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	1294-1295	2
α-helix	1297-1313	17
β-strand	1321-1334	14	2
α-helix	1335-1336	2
α-helix	1337-1339	3
α-helix	1340-1344	5
β-strand	1352-1366	15	2
β-strand	1369-1381	13	2
α-helix	1386	1
β-strand	1392-1400	9	2
α-helix	1407-1409	3
α-helix	1410-1428	19
β-strand	1432-1436	5	2
α-helix	1439-1441	3
α-helix	1460-1476	17
β-strand	1482-1485	4	2
α-helix	1486-1492	7
α-helix	1498-1500	3
α-helix	1508-1515	8
α-helix	1583-1590	8
α-helix	1592-1594	3
β-strand	1595-1599	5	2
α-helix	1603-1607	5
α-helix	1609-1612	4
α-helix	1617-1618	2
β-strand	1619	1	2
α-helix	1622-1624	3
α-helix	1628-1636	9
α-helix	1644-1660	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone acetyltransferase p300	A, B	protein	323	Homo sapiens	Q09472 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6PGU_1 Histone acetyltransferase p300 (chains A, B)
GSKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFV
DSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFF
RPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQ
EWFKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKESGGSG
SQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLE
FSSLRRAQWSTMCMLVELHTQSQ

Ligands and cofactors

ID	Name	Formula	Copies
OK7	N-(thiophen-2-yl)acetamide	C6 H7 N O S	2
COA	Coenzyme a	C21 H36 N7 O16 P3 S	2

Primary citation

Make the right measurement: Discovery of an allosteric inhibition site for p300-HAT. Gardberg, A.S., Huhn, A.J., Cummings, R. et al. Struct Dyn (2019) 6:054702-054702. DOI 10.1063/1.5119336 · PubMed

Other PDB entries of the same protein (UniProt Q09472 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BT3 1.05 Å, Crystal structure of EP300 bromodomain in complex with SGC-CBP30 chemical probe
3T92 1.5 Å, Crystal structure of the Taz2:C/EBPepsilon-TAD chimera protein
5LPM 1.5 Å, Crystal structure of the bromodomain of human Ep300 bound to the inhibitor XDM3d
5NU5 1.6 Å, Crystal structure of the human bromodomain of EP300 bound to the inhibitor XDM-CBP
3BIY 1.7 Å, Crystal structure of p300 histone acetyltransferase domain in complex with a bisubstrate…
6V8K 1.84 Å, Crystal structure of the p300 acetyltransferase domain with peptide-competitive…
4PZS 1.94 Å, Crystal structure of p300 histone acetyltransferase domain in complex with…
5KJ2 1.95 Å, The novel p300/CBP inhibitor A-485 uncovers a unique mechanism of action to target AR in…
6DS6 1.95 Å, Crystal structure of p300 ZZ domain in complex with histone H3 peptide
7QGS 2.0 Å, Crystal structure of p300 CH1 domain in complex with CITIF (a CITED2-HIF-1alpha hybrid)
7UGI 2.0 Å, Bromodomain of EP300 liganded with BMS-536924
7VHZ 2.0 Å, Crystal structure of EP300 HAT domain in complex with compound 7

Browse structure collections

About this viewer

MolViewer shows 6PGU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.