6QBY: VASH 2

Crystal structure of VASH 2 in complex with SVBP. Determined by X-ray diffraction at 2.09 Å resolution. Released 24 Apr 2019.

Method: X-ray diffraction
Resolution: 2.09 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,703
Mol. weight: 77.82 kDa
Released: 24 Apr 2019

Explore 6QBY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6QBY contains 25 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	50-51	2	1
α-helix	58-59	2
α-helix	60-73	14
α-helix	77-85	9
α-helix	91-94	4
α-helix	96-99	4
α-helix	107-121	15
β-strand	123	1	2
β-strand	128-129	2	1
β-strand	138	1	3
α-helix	139-152	14
β-strand	156	1	2
α-helix	158-169	12
β-strand	176-186	11	4
β-strand	189-200	12	4
β-strand	203-207	5	4
β-strand	218-222	5	4
α-helix	225-237	13
β-strand	242-248	7	4
α-helix	250-253	4
α-helix	260	1
β-strand	261	1	3
α-helix	262	1
β-strand	267-269	3	4
α-helix	276-291	16

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	27-52	26

Chain C: 10 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	50-51	2	5
α-helix	58-59	2
α-helix	60-73	14
α-helix	77-85	9
α-helix	93-99	7
α-helix	107-121	15
β-strand	123	1	6
β-strand	128-129	2	5
α-helix	139-152	14
β-strand	156	1	6
α-helix	158-169	12
β-strand	176-186	11	7
β-strand	189-200	12	7
β-strand	203-207	5	7
β-strand	218-222	5	7
α-helix	225-237	13
β-strand	242-248	7	7
α-helix	250-253	4
β-strand	267-269	3	7
α-helix	276-292	17

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	30-56	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tubulinyl-Tyr carboxypeptidase 2	A, C	protein	257	Homo sapiens	Q86V25 (AlphaFold model)
Small vasohibin-binding protein	B, D	protein	74	Homo sapiens	Q8N300 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>6QBY_1 Tubulinyl-Tyr carboxypeptidase 2 (chains A, C)
MEEDKDGGVLFHVNKSGFPIDSHTWERMWMHVAKVHPKGGEMVGAIRNAAFLAKPSIPQV
PNYRLSMTIPDWLQAIQNYMKTLQYNHTGTQFFEIRKMRPLSGLMETAKEMTRESLPIKC
LEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDK
PLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRAD
IRKELEKYARDMRMKIL

Sequence of entity 2 (B, D), FASTA

>6QBY_2 Small vasohibin-binding protein (chains B, D)
MMDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCK
QMQPPGEKHHHHHH

Primary citation

Structural basis of tubulin detyrosination by the vasohibin-SVBP enzyme complex. Wang, N., Bosc, C., Ryul Choi, S. et al. Nat Struct Mol Biol (2019) 26:571-582. DOI 10.1038/s41594-019-0241-y · PubMed

Other PDB entries of the same protein (UniProt Q86V25 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6J4P 1.6 Å, Structural basis of tubulin detyrosination by vasohibins-SVBP enzyme complex and…
6J4V 2.1 Å, Structural basis of tubulin detyrosination by vasohibins-SVBP enzyme complex and…
6J4O 2.3 Å, Structural basis of tubulin detyrosination by vasohibins-SVBP enzyme complex and…
6J4Q 2.7 Å, Structural basis of tubulin detyrosination by vasohibins-SVBP enzyme complex and…
6J4S 2.8 Å, Structural basis of tubulin detyrosination by vasohibins-SVBP enzyme complex and…
7ZCW 3.6 Å, Cryo-EM structure of GMPCPP-microtubules in complex with VASH2-SVBP

Browse structure collections

About this viewer

MolViewer shows 6QBY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.