6QCG: Proliferating cell nuclear antigen

PCNA complex with Cdt1 N-terminal PIP-box peptide. Determined by X-ray diffraction at 3.4 Å resolution. Released 23 Jan 2019.

Method: X-ray diffraction
Resolution: 3.4 Å
Organism: Homo sapiens
Chains: 12
Atoms: 12,123
Mol. weight: 184.94 kDa
Released: 23 Jan 2019

Explore 6QCG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6QCG contains 47 α-helices and 116 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and E: 7 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
α-helix	10-20	11
β-strand	25-31	7	2
β-strand	34-40	7	2
β-strand	46-53	8	2
α-helix	54-56	3
β-strand	59-62	4	1
β-strand	66-71	6	2
α-helix	72-79	8
β-strand	87-92	6	1
β-strand	98-104	7	1
β-strand	110-117	8	1
β-strand	119	1	2
β-strand	135-140	6	2
α-helix	141-152	12
β-strand	157-162	6	3
β-strand	166-172	7	3
β-strand	176-183	8	3
α-helix	184	1
β-strand	196-199	4	2
β-strand	203-208	6	3
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-230	7	2
β-strand	233-241	9	2
β-strand	245-251	7	2

Chain D: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	10
α-helix	10-20	11
β-strand	25-31	7	11
β-strand	34-40	7	11
β-strand	46-53	8	11
α-helix	54-56	3
β-strand	59-62	4	10
β-strand	66-71	6	11
α-helix	72-79	8
β-strand	87-92	6	10
β-strand	98-104	7	10
β-strand	110-117	8	10
β-strand	119	1	11
β-strand	127	1	12
β-strand	135-140	6	11
α-helix	141-152	12
β-strand	157-162	6	7
β-strand	166-172	7	7
β-strand	176-183	8	7
α-helix	184	1
β-strand	196-199	4	11
β-strand	203-208	6	7
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-230	7	11
β-strand	233-241	9	11
β-strand	245-251	7	11

Chain F: 8 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	9
α-helix	10-20	11
β-strand	25-31	7	13
β-strand	34-40	7	13
β-strand	46-53	8	13
α-helix	54-56	3
β-strand	59-62	4	9
β-strand	66-71	6	13
α-helix	72-79	8
β-strand	87-92	6	9
α-helix	94-96	3
β-strand	98-104	7	9
β-strand	110-117	8	9
β-strand	119	1	13
β-strand	135-140	6	13
α-helix	141-152	12
β-strand	157-162	6	10
β-strand	166-172	7	10
β-strand	176-183	8	10
α-helix	184-185	2
β-strand	196-199	4	13
β-strand	203-208	6	10
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-230	7	13
β-strand	233-241	9	13
β-strand	245-251	7	13

Chains G, K and L: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3

Chain J: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	7-10	4
β-strand	12	1	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proliferating cell nuclear antigen	A, B, C, D, E, F	protein	263	Homo sapiens	P12004 (AlphaFold model)
DNA replication factor Cdt1	G, H, I, J, K, L	protein	14	Homo sapiens	Q9H211 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>6QCG_1 Proliferating cell nuclear antigen (chains A, B, C, D, E, F)
GPMFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFD
TYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKL
MDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNG
NIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVE
YKIADMGHLKYYLAPKIEDEEGS

Sequence of entity 2 (G, H, I, J, K, L), FASTA

>6QCG_2 DNA replication factor Cdt1 (chains G, H, I, J, K, L)
MEQRRVTDFFARRR

Primary citation

Direct binding of Cdt2 to PCNA is important for targeting the CRL4Cdt2E3 ligase activity to Cdt1. Hayashi, A., Giakoumakis, N.N., Heidebrecht, T. et al. Life Sci Alliance (2018) 1:e201800238-e201800238. DOI 10.26508/lsa.201800238 · PubMed

Other PDB entries of the same protein (UniProt P12004 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1U7B 1.88 Å, Crystal structure of hPCNA bound to residues 331-350 of the flap endonuclease-1 (FEN1)
8F5Q 1.9 Å, Crystal structure of human PCNA in complex with the PIP box of FBH1
9N3L 1.9 Å, Co-crystal structure of PCNA bound to HSP90alpha inhibitor, SNX2112
5E0U 1.93 Å, Human PCNA variant (S228I) complexed with p21 at 1.9 Angstroms
5MLO 1.96 Å, Crystal structure of human PCNA in complex with ZRANB3 PIP box peptide
4RJF 2.01 Å, Crystal structure of the human sliding clamp at 2.0 angstrom resolution
5E0V 2.07 Å, Human PCNA variant (S228I) complexed with FEN1 at 2.1 Angstroms
3VKX 2.1 Å, Structure of PCNA
6HVO 2.1 Å, Crystal structure of human PCNA in complex with three peptides of p12 subunit of human…
4ZTD 2.2 Å, Crystal Structure of Human PCNA in complex with a TRAIP peptide
5YCO 2.2 Å, Complex structure of PCNA with UHRF2
5MOM 2.27 Å, Crystal Structure of PCNA encoding the hypomorphic mutation S228I

Browse structure collections

About this viewer

MolViewer shows 6QCG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.