6QJD: Disks large homolog 4

Crystal Structure of the truncated form of the third PDZ domain of PSD-95: residues 302-392. Determined by X-ray diffraction at 1.55 Å resolution. Released 17 Apr 2019.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,768
Mol. weight: 40.31 kDa
Released: 17 Apr 2019

Explore 6QJD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6QJD contains 12 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	309-311	3
β-strand	312-317	6	1
α-helix	318	1
β-strand	325-328	4	1
β-strand	337-341	5	1
β-strand	358-362	5	1
β-strand	365-366	2	1
α-helix	372-380	9
β-strand	385-391	7	1

Chain B: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	309-311	3
β-strand	312-317	6	2
β-strand	319	1	3
β-strand	322	1	3
β-strand	325-328	4	2
β-strand	337-341	5	2
α-helix	346-349	4
α-helix	357	1
β-strand	358-362	5	2
β-strand	365-366	2	2
α-helix	372-380	9
β-strand	385-391	7	2

Chain C: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	308-311	4
β-strand	312-317	6	4
β-strand	319	1	5
β-strand	322	1	5
β-strand	325-329	5	4
β-strand	336-341	6	4
β-strand	358-362	5	4
β-strand	365-366	2	4
α-helix	372-380	9
β-strand	385-391	7	4

Chain D: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	309-311	3
β-strand	312-317	6	6
β-strand	325-328	4	6
β-strand	337-341	5	6
α-helix	346-349	4
β-strand	358-362	5	6
β-strand	365-366	2	6
α-helix	372-380	9
β-strand	385-391	7	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 4	A, B, C, D	protein	94	Homo sapiens	P78352 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>6QJD_1 Disks large homolog 4 (chains A, B, C, D)
MGLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQI
LSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK

Primary citation

Conformational changes in the third PDZ domain of the neuronal postsynaptic density protein 95. Camara-Artigas, A., Murciano-Calles, J., Martinez, J.C. Acta Crystallogr D Struct Biol (2019) 75:381-391. DOI 10.1107/S2059798319001980 · PubMed

Other PDB entries of the same protein (UniProt P78352 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9TNG 0.95 Å, Crystal Structure of the third PDZ domain of PSD-95 protein E401R mutant
6QJL 1.04 Å, Crystal Structure of the third PDZ domain of PSD-95 protein D332G mutant: space group P21
6QJK 1.05 Å, Crystal Structure of the third PDZ domain of PSD-95 protein D332G mutant: space group P43
8AH5 1.25 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P212121…
8AH7 1.25 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P212121…
3I4W 1.35 Å, Crystal Structure of the third PDZ domain of PSD-95
3K82 1.4 Å, Crystal Structure of the third PDZ domain of PSD-95
9TNF 1.45 Å, Crystal Structure of the third PDZ domain of PSD-95 protein Y397E mutant
8AH4 1.48 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P3112 at…
6QJF 1.5 Å, Crystal Structure of the third PDZ domain of PSD-95 protein D332P mutant: space group…
6QJI 1.5 Å, Crystal Structure of the third PDZ domain of PSD-95 protein: space group P3112
8AH8 1.5 Å, Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P3121 at…

Browse structure collections

About this viewer

MolViewer shows 6QJD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.