6QT8: Rea1-MIDAS domain from Chaetomium thermophilum

Name: PDB 6QT8: Crystal structure of Rea1-MIDAS domain from Chaetomium thermophilum
Published: 2019-08-07
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ribosome

Crystal structure of Rea1-MIDAS domain from Chaetomium thermophilum. Determined by X-ray diffraction at 2.33 Å resolution. Released 7 Aug 2019.

Method: X-ray diffraction
Resolution: 2.33 Å
Organism: Chaetomium thermophilum var. thermophilum DSM 1495
Chains: 1
Atoms: 2,360
Mol. weight: 39.21 kDa
Released: 7 Aug 2019

Explore 6QT8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6QT8 contains 15 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4698-4702	5
α-helix	4703-4732	30
α-helix	4736-4738	3
α-helix	4763-4771	9
β-strand	4778-4787	10	1
β-strand	4789	1	2
α-helix	4790-4792	3
α-helix	4794-4796	3
α-helix	4800-4818	19
β-strand	4822-4828	7	1
β-strand	4832-4836	5	1
α-helix	4841-4842	2
α-helix	4846-4854	9
β-strand	4860	1	2
α-helix	4865-4884	20
β-strand	4892-4902	11	1
α-helix	4908-4922	15
β-strand	4926-4932	7	1
α-helix	4943-4948	6
α-helix	4960-4965	6
β-strand	4970-4974	5	1
α-helix	4977-4979	3
α-helix	4980-4996	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Midasin	A	protein	336	Chaetomium thermophilum var. thermophilum DSM 1495	G0SHE6

Sequence of entity 1 (A), FASTA

>6QT8_1 Midasin (chains A)
MEEDLEDEQIKEASSQLLATHISDEQLKRPLRDYGEALEMWSTFQTKTQALSQSLSSQLR
LILTPTQSTKLSGAFRTGKRLNIKKIIPYIASSYKRDKIWMRRAIPSKRAYQILLCVDDS
SSMSDDNRSTAGNLALESLVMVARALTVLEAGQIGVMGFGTDVFVAHALTDPPFTSQDAG
ARVLQQFTFRQDSTDMVLLLRRTIDHFREARLIQASSSRGGEDLWQLALILSDGLVQSRD
HARLRPLLREAMEQRVMVVFIVMDDARSRKGHSVLELKEARFGPDGVPVIHRYLDSFPFP
YYLIVHHLEDLPGALAALLRTWFAEVNSGSHHHHHH

Primary citation

Crystal structures of Rea1-MIDAS bound to its ribosome assembly factor ligands resembling integrin-ligand-type complexes. Ahmed, Y.L., Thoms, M., Mitterer, V. et al. Nat Commun (2019) 10:3050-3050. DOI 10.1038/s41467-019-10922-6 · PubMed

Other PDB entries of the same protein (UniProt G0SHE6), best resolution first:

6QTA 1.89 Å, Crystal structure of Rea1-MIDAS/Rsa4-UBL complex from Chaetomium thermophilum
6QTB 1.89 Å, Crystal structure of Rea1-MIDAS/Ytm1-UBL complex from Chaetomium thermophilum

Browse structure collections

About this viewer

MolViewer shows 6QT8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.