6QTA: Midasin,Midasin

Name: PDB 6QTA: Crystal structure of Rea1-MIDAS/Rsa4-UBL complex from Chaetomium thermophilum
Published: 2019-08-07
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ribosome

Crystal structure of Rea1-MIDAS/Rsa4-UBL complex from Chaetomium thermophilum. Determined by X-ray diffraction at 1.89 Å resolution. Released 7 Aug 2019.

Method: X-ray diffraction
Resolution: 1.89 Å
Organism: Chaetomium thermophilum var. thermophilum DSM 1495
Chains: 2
Atoms: 3,140
Mol. weight: 44.75 kDa
Ligands: MG
Released: 7 Aug 2019

Explore 6QTA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6QTA contains 20 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	4697-4699	3
α-helix	4703-4732	30
β-strand	4780-4787	8	1
β-strand	4789	1	2
α-helix	4790-4793	4
α-helix	4800-4818	19
β-strand	4821-4828	8	1
β-strand	4832-4836	5	1
α-helix	4846-4853	8
β-strand	4860	1	2
α-helix	4865-4885	21
β-strand	4894-4901	8	1
α-helix	4908-4922	15
β-strand	4926-4932	7	1
α-helix	4938	1
β-strand	4947-4951	5	3
β-strand	4957-4961	5	3
α-helix	4962-4965	4
β-strand	4971-4974	4	1
α-helix	4977-4979	3
α-helix	4980-4995	16

Chain B: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	36-42	7	3
β-strand	48	1	3
β-strand	53-56	4	3
α-helix	57-59	3
α-helix	62-72	11
α-helix	77-79	3
α-helix	80-82	3
β-strand	83-88	6	3
α-helix	89	1
β-strand	95-96	2	3
α-helix	99-100	2
α-helix	103-109	7
α-helix	115-117	3
α-helix	119	1
β-strand	120-126	7	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Midasin,Midasin	A	protein	280	Chaetomium thermophilum var. thermophilum DSM 1495	G0SHE6
Ribosome assembly protein 4	B	protein	108	Chaetomium thermophilum var. thermophilum DSM 1495	G0SC29 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6QTA_1 Midasin,Midasin (chains A)
MHISDEQLKRPLRDYGEALEMWSTFQTKTQALSQSLSSQLRLILTGSGIPSKRAYQILLC
VDDSSSMSDDNRSTAGNLALESLVMVARALTVLEAGQIGVMGFGTDVFVAHALTDPPFTS
QDAGARVLQQFTFRQDSTDMVLLLRRTIDHFREARLIQASSSRGGEDLWQLALILSDGLV
QSRDHARLRPLLREAMEQRVMVVFIVMDDARSRKGHSVLELKEARFGPDGVPVIHRYLDS
FPFPYYLIVHHLEDLPGALAALLRTWFAEVNSGSHHHHHH

Sequence of entity 2 (B), FASTA

>6QTA_2 Ribosome assembly protein 4 (chains B)
MKHHHHHHPMATDLGSFKANFIDSDGNQMTDVVEINFADATEKNISNLLNTLLGRDREEF
TPYRFRIHIPGKDLIIDQYPNDLLSLLQKHGVTNPFETTITLSAEPQA

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Water and common crystallization additives (GOL, SO4) are not listed.

Primary citation

Crystal structures of Rea1-MIDAS bound to its ribosome assembly factor ligands resembling integrin-ligand-type complexes. Ahmed, Y.L., Thoms, M., Mitterer, V. et al. Nat Commun (2019) 10:3050-3050. DOI 10.1038/s41467-019-10922-6 · PubMed

Other PDB entries of the same protein (UniProt G0SHE6), best resolution first:

6QTB 1.89 Å, Crystal structure of Rea1-MIDAS/Ytm1-UBL complex from Chaetomium thermophilum
6QT8 2.33 Å, Crystal structure of Rea1-MIDAS domain from Chaetomium thermophilum

Browse structure collections

About this viewer

MolViewer shows 6QTA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.