Crystal structure of a mutant Arabidopsis WD40 domain in complex with a transcription factor. Determined by X-ray diffraction at 1.37 Å resolution. Released 10 Jul 2019.
Explore 6QTR in 3D Show helices and sheets RCSB PDB PDBe
6QTR contains 3 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 350-352 | 3 | |
| β-strand | 355-362 | 8 | 1 |
| β-strand | 374-379 | 6 | 2 |
| β-strand | 385-390 | 6 | 2 |
| β-strand | 394-399 | 6 | 2 |
| α-helix | 400-405 | 6 | |
| β-strand | 415-418 | 4 | 2 |
| β-strand | 423-428 | 6 | 3 |
| β-strand | 435-440 | 6 | 3 |
| β-strand | 445-449 | 5 | 3 |
| β-strand | 455-459 | 5 | 3 |
| β-strand | 466-471 | 6 | 4 |
| β-strand | 478-483 | 6 | 4 |
| β-strand | 487-492 | 6 | 4 |
| β-strand | 500-503 | 4 | 4 |
| β-strand | 508-513 | 6 | 5 |
| β-strand | 520-525 | 6 | 5 |
| β-strand | 530-534 | 5 | 5 |
| β-strand | 543-545 | 3 | 5 |
| β-strand | 552-557 | 6 | 6 |
| β-strand | 562-567 | 6 | 6 |
| β-strand | 571-576 | 6 | 6 |
| β-strand | 581-586 | 6 | 6 |
| β-strand | 594 | 1 | 7 |
| β-strand | 598-600 | 3 | 8 |
| β-strand | 604-607 | 4 | 8 |
| β-strand | 613-618 | 6 | 8 |
| β-strand | 626-629 | 4 | 8 |
| β-strand | 647-652 | 6 | 1 |
| β-strand | 658-663 | 6 | 1 |
| β-strand | 668-674 | 7 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 42 | 1 | 7 |
| α-helix | 43-44 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase COP1 | A | protein | 330 | Arabidopsis thaliana | P43254 (AlphaFold model) |
| Transcription factor HY5 | B | protein | 12 | Arabidopsis thaliana | O24646 (AlphaFold model) |
>6QTR_1 E3 ubiquitin-protein ligase COP1 (chains A) GAMTFTRYSRLRVIAEIRHGDIFHSANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVN EPADMQCPIVEMSTRSKLSCLSWNKHEKNHIASSDYEGIVTVWDVTTRQSLMEYEEHEKR AWSVDFSRTEPSMLVSGSDDCKVKVWCTRQEASVINIDMKANICCVKYNPGSSNYIAVGS ADHHIHYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRT FRGHTNEKNFVGLTVNSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMDDAEEEAGSY FISAVCWKSDSPTMLTANSQGTIKVLVLAA
>6QTR_2 Transcription factor HY5 (chains B) XEIRRVPEFGGY
Plant photoreceptors and their signaling components compete for COP1 binding via VP peptide motifs. Lau, K., Podolec, R., Chappuis, R. et al. EMBO J (2019) 38:e102140-e102140. DOI 10.15252/embj.2019102140 · PubMed
Other PDB entries of the same protein (UniProt P43254 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6QTR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.