Solution structure of the ASHH2 CW domain with the N-terminal histone H3 tail mimicking peptide monomethylated on lysine 4. Determined by solution NMR. Released 4 Dec 2019.
Explore 6QXZ in 3D Show helices and sheets RCSB PDB PDBe
6QXZ contains 3 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 864-867 | 4 | 1 |
| β-strand | 874-877 | 4 | 1 |
| α-helix | 879-882 | 4 | |
| α-helix | 893-895 | 3 | |
| α-helix | 912-919 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone-lysine N-methyltransferase ASHH2 | A | protein | 79 | Arabidopsis thaliana | Q2LAE1 (AlphaFold model) |
| Ala-arg-thr-mlz-gln-thr-ala-arg-tyr | B | protein | 9 | Homo sapiens | P68431 (AlphaFold model) |
>6QXZ_1 Histone-lysine N-methyltransferase ASHH2 (chains A) GSRRASVGSEFTESAWVRCDDCFKWRRIPASVVGSIDESSRWICMNNSDKRFADCSKSQE MSNEEINEELGIGQDEADA
>6QXZ_2 ALA-ARG-THR-MLZ-GLN-THR-ALA-ARG-TYR (chains B) ARTKQTARY
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
The Arabidopsis (ASHH2) CW domain binds monomethylated K4 of the histone H3 tail through conformational selection. Dobrovolska, O., Brilkov, M., Madeleine, N. et al. FEBS J (2020) 287:4458-4480. DOI 10.1111/febs.15256 · PubMed
Other PDB entries of the same protein (UniProt Q2LAE1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6QXZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.