6R15: SUN1-KASH1 6:6 complex

Crystal structure of the SUN1-KASH1 6:6 complex. Determined by X-ray diffraction at 1.82 Å resolution. Released 1 Apr 2020.

Method: X-ray diffraction
Resolution: 1.82 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,107
Mol. weight: 26.56 kDa
Released: 1 Apr 2020

Explore 6R15 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6R15 contains 10 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	616-618	3
α-helix	619-634	16
α-helix	646-648	3
β-strand	651-654	4	1
β-strand	660	1	2
β-strand	667-670	4	3
β-strand	673-677	5	3
α-helix	682-686	5
β-strand	696-699	4	2
β-strand	703-721	19	1
α-helix	725-727	3
β-strand	737	1	4
β-strand	739-745	7	1
β-strand	754-760	7	1
β-strand	768-772	5	1
α-helix	773-775	3
β-strand	782-789	8	1
β-strand	792	1	4
β-strand	798-801	4	2
β-strand	803-810	8	1

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	8770-8776	7
α-helix	8779-8782	4
α-helix	8786-8787	2
α-helix	8794-8796	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SUN domain-containing protein 1	A	protein	203	Homo sapiens	O94901 (AlphaFold model)
Nesprin-1	B	protein	32	Homo sapiens	Q8NF91 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6R15_1 SUN domain-containing protein 1 (chains A)
GSGGSGGITEAQARAIVNSALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALMS
LFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIHPAAFTLEHIPKTLSP
TGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGESLQMFQALKRPDDTAFQIVELRI
FSNWGHPEYTCLYRFRVHGEPVK

Sequence of entity 2 (B), FASTA

>6R15_2 Nesprin-1 (chains B)
GSMEEDYSCALSNNFARSFHPMLRYTNGPPPL

Primary citation

A molecular mechanism for LINC complex branching by structurally diverse SUN-KASH 6:6 assemblies. Gurusaran, M., Davies, O.R. Elife (2021) 10. DOI 10.7554/eLife.60175 · PubMed

Other PDB entries of the same protein (UniProt O94901 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6R2I 1.54 Å, Crystal structure of the SUN1-KASH5 6:6 complex
8B46 1.67 Å, Crystal structure of the SUN1-KASH6 9:9 complex
8B5X 1.98 Å, Crystal structure of the SUN1-KASH6 9:6 complex
8AU0 2.07 Å, Crystal structure of the a1 luminal coiled-coil domain of SUN1
7Z8Y 2.29 Å, Crystal structure of the SUN1-KASH6 9:6 complex
6R16 2.75 Å, Crystal structure of the SUN1-KASH4 6:6 complex
7E34 3.19 Å, Crystal structure of SUN1-Speedy A-CDK2

Browse structure collections

About this viewer

MolViewer shows 6R15 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.