Crystal structure of the SUN1-KASH1 6:6 complex. Determined by X-ray diffraction at 1.82 Å resolution. Released 1 Apr 2020.
Explore 6R15 in 3D Show helices and sheets RCSB PDB PDBe
6R15 contains 10 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 616-618 | 3 | |
| α-helix | 619-634 | 16 | |
| α-helix | 646-648 | 3 | |
| β-strand | 651-654 | 4 | 1 |
| β-strand | 660 | 1 | 2 |
| β-strand | 667-670 | 4 | 3 |
| β-strand | 673-677 | 5 | 3 |
| α-helix | 682-686 | 5 | |
| β-strand | 696-699 | 4 | 2 |
| β-strand | 703-721 | 19 | 1 |
| α-helix | 725-727 | 3 | |
| β-strand | 737 | 1 | 4 |
| β-strand | 739-745 | 7 | 1 |
| β-strand | 754-760 | 7 | 1 |
| β-strand | 768-772 | 5 | 1 |
| α-helix | 773-775 | 3 | |
| β-strand | 782-789 | 8 | 1 |
| β-strand | 792 | 1 | 4 |
| β-strand | 798-801 | 4 | 2 |
| β-strand | 803-810 | 8 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8770-8776 | 7 | |
| α-helix | 8779-8782 | 4 | |
| α-helix | 8786-8787 | 2 | |
| α-helix | 8794-8796 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SUN domain-containing protein 1 | A | protein | 203 | Homo sapiens | O94901 (AlphaFold model) |
| Nesprin-1 | B | protein | 32 | Homo sapiens | Q8NF91 (AlphaFold model) |
>6R15_1 SUN domain-containing protein 1 (chains A) GSGGSGGITEAQARAIVNSALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALMS LFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIHPAAFTLEHIPKTLSP TGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGESLQMFQALKRPDDTAFQIVELRI FSNWGHPEYTCLYRFRVHGEPVK
>6R15_2 Nesprin-1 (chains B) GSMEEDYSCALSNNFARSFHPMLRYTNGPPPL
A molecular mechanism for LINC complex branching by structurally diverse SUN-KASH 6:6 assemblies. Gurusaran, M., Davies, O.R. Elife (2021) 10. DOI 10.7554/eLife.60175 · PubMed
Other PDB entries of the same protein (UniProt O94901 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6R15 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.