6R16: SUN1-KASH4 6:6 complex
Crystal structure of the SUN1-KASH4 6:6 complex. Determined by X-ray diffraction at 2.75 Å resolution. Released 15 Jul 2020.
- Method
- X-ray diffraction
- Resolution
- 2.75 Å
- Organism
- Homo sapiens
- Chains
- 12
- Atoms
- 10,562
- Mol. weight
- 155.62 kDa
- Ligands
- ZN
- Released
- 15 Jul 2020
Explore 6R16 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6R16 contains 50 α-helices and 78 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A and C: 7 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 619-634 | 16 | |
| β-strand | 651-652 | 2 | 1 |
| α-helix | 654-656 | 3 | |
| α-helix | 658-659 | 2 | |
| β-strand | 660 | 1 | 2 |
| α-helix | 661-662 | 2 | |
| β-strand | 666-670 | 5 | 3 |
| β-strand | 673-678 | 6 | 3 |
| α-helix | 682-686 | 5 | |
| β-strand | 696-699 | 4 | 2 |
| β-strand | 703-721 | 19 | 1 |
| α-helix | 725-727 | 3 | |
| β-strand | 737-745 | 9 | 1 |
| β-strand | 754-760 | 7 | 1 |
| β-strand | 768-772 | 5 | 1 |
| α-helix | 773-775 | 3 | |
| β-strand | 782-792 | 11 | 1 |
| β-strand | 798-801 | 4 | 2 |
| β-strand | 803-810 | 8 | 1 |
Chain B: 7 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 621-634 | 14 | |
| β-strand | 651-652 | 2 | 4 |
| α-helix | 654-656 | 3 | |
| α-helix | 658-659 | 2 | |
| β-strand | 660 | 1 | 5 |
| α-helix | 661-662 | 2 | |
| β-strand | 666-670 | 5 | 6 |
| β-strand | 673-678 | 6 | 6 |
| α-helix | 682-686 | 5 | |
| β-strand | 696-699 | 4 | 5 |
| β-strand | 703-721 | 19 | 4 |
| α-helix | 725-727 | 3 | |
| β-strand | 737-745 | 9 | 4 |
| β-strand | 754-760 | 7 | 4 |
| β-strand | 768-772 | 5 | 4 |
| α-helix | 773-774 | 2 | |
| β-strand | 782-792 | 11 | 4 |
| β-strand | 798-801 | 4 | 5 |
| β-strand | 803-810 | 8 | 4 |
Chain D: 6 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 619-634 | 16 | |
| β-strand | 651-657 | 7 | 10 |
| α-helix | 659 | 1 | |
| β-strand | 660 | 1 | 11 |
| α-helix | 661-662 | 2 | |
| β-strand | 666-670 | 5 | 12 |
| β-strand | 673-678 | 6 | 12 |
| α-helix | 682-686 | 5 | |
| β-strand | 696-699 | 4 | 11 |
| β-strand | 703-721 | 19 | 10 |
| α-helix | 725-727 | 3 | |
| β-strand | 737-745 | 9 | 10 |
| β-strand | 754-760 | 7 | 10 |
| β-strand | 768-772 | 5 | 10 |
| α-helix | 773-774 | 2 | |
| β-strand | 782-792 | 11 | 10 |
| β-strand | 798-801 | 4 | 11 |
| β-strand | 803-810 | 8 | 10 |
Chains E and F: 7 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 619-634 | 16 | |
| β-strand | 651-652 | 2 | 13 |
| α-helix | 654-656 | 3 | |
| α-helix | 658-659 | 2 | |
| β-strand | 660 | 1 | 14 |
| α-helix | 661-662 | 2 | |
| β-strand | 666-670 | 5 | 15 |
| β-strand | 673-677 | 5 | 15 |
| α-helix | 682-686 | 5 | |
| β-strand | 696-699 | 4 | 14 |
| β-strand | 703-721 | 19 | 13 |
| α-helix | 725-727 | 3 | |
| β-strand | 737-745 | 9 | 13 |
| β-strand | 754-760 | 7 | 13 |
| β-strand | 768-772 | 5 | 13 |
| α-helix | 773-775 | 3 | |
| β-strand | 782-792 | 11 | 13 |
| β-strand | 798-801 | 4 | 14 |
| β-strand | 803-810 | 8 | 13 |
Chains G, H and K: 1 helix, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 393-397 | 5 | 15 |
| α-helix | 401-403 | 3 | |
Chain I: 2 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 387-391 | 5 | |
| β-strand | 393-397 | 5 | 3 |
| α-helix | 401-403 | 3 | |
Chains J and L: 2 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 390-391 | 2 | |
| β-strand | 393-397 | 5 | 6 |
| α-helix | 401-403 | 3 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| SUN domain-containing protein 1 | A, B, C, D, E, F | protein | 203 | Homo sapiens | O94901 (AlphaFold model) |
| Nesprin-4 | G, H, I, J, K, L | protein | 32 | Homo sapiens | Q8N205 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F), FASTA
>6R16_1 SUN domain-containing protein 1 (chains A, B, C, D, E, F)
GSGGSGGITEAQARAIVNSALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALMS
LFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIHPAAFTLEHIPKTLSP
TGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGESLQMFQALKRPDDTAFQIVELRI
FSNWGHPEYTCLYRFRVHGEPVK
Sequence of entity 2 (G, H, I, J, K, L), FASTA
>6R16_2 Nesprin-4 (chains G, H, I, J, K, L)
GSMASGGPCCSHARIPRTPYLVLSYVNGLPPV
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| ZN | Zinc ion | Zn | 3 |
Water and common crystallization additives (EDO, K) are not listed.
Primary citation
A molecular mechanism for LINC complex branching by structurally diverse SUN-KASH 6:6 assemblies. Gurusaran, M., Davies, O.R. Elife (2021) 10. DOI 10.7554/eLife.60175 · PubMed
Other PDB entries of the same protein (UniProt O94901 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6R2I 1.54 Å, Crystal structure of the SUN1-KASH5 6:6 complex
- 8B46 1.67 Å, Crystal structure of the SUN1-KASH6 9:9 complex
- 6R15 1.82 Å, Crystal structure of the SUN1-KASH1 6:6 complex
- 8B5X 1.98 Å, Crystal structure of the SUN1-KASH6 9:6 complex
- 8AU0 2.07 Å, Crystal structure of the a1 luminal coiled-coil domain of SUN1
- 7Z8Y 2.29 Å, Crystal structure of the SUN1-KASH6 9:6 complex
- 7E34 3.19 Å, Crystal structure of SUN1-Speedy A-CDK2
Browse structure collections
About this viewer
MolViewer shows 6R16 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.