Structure based optimization of JAK1-ATP binding pocket Inhibitors in the aminopyrazole class. Determined by X-ray diffraction at 1.71 Å resolution. Released 8 Jul 2020.
Explore 6RSH in 3D Show helices and sheets RCSB PDB PDBe
6RSH contains 38 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 869 | 1 | 1 |
| α-helix | 872-874 | 3 | |
| β-strand | 875-883 | 9 | 1 |
| β-strand | 887-894 | 8 | 1 |
| β-strand | 903-910 | 8 | 1 |
| α-helix | 918-930 | 13 | |
| β-strand | 937 | 1 | 2 |
| α-helix | 938-939 | 2 | |
| β-strand | 940-944 | 5 | 1 |
| β-strand | 953-957 | 5 | 1 |
| β-strand | 963 | 1 | 2 |
| α-helix | 964-971 | 8 | |
| α-helix | 977-996 | 20 | |
| β-strand | 999-1000 | 2 | 3 |
| α-helix | 1006-1008 | 3 | |
| β-strand | 1009-1013 | 5 | 2 |
| β-strand | 1016-1019 | 4 | 2 |
| β-strand | 1026-1027 | 2 | 3 |
| α-helix | 1028-1029 | 2 | |
| β-strand | 1034-1036 | 3 | 4 |
| α-helix | 1045-1047 | 3 | |
| α-helix | 1050-1055 | 6 | |
| β-strand | 1057-1059 | 3 | 4 |
| α-helix | 1060-1075 | 16 | |
| α-helix | 1080-1082 | 3 | |
| α-helix | 1084-1092 | 9 | |
| α-helix | 1097-1099 | 3 | |
| α-helix | 1100-1109 | 10 | |
| α-helix | 1114-1117 | 4 | |
| α-helix | 1122-1130 | 9 | |
| α-helix | 1136-1138 | 3 | |
| α-helix | 1140-1141 | 2 | |
| α-helix | 1142-1153 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 869 | 1 | 5 |
| α-helix | 872-874 | 3 | |
| β-strand | 875-883 | 9 | 5 |
| β-strand | 887-894 | 8 | 5 |
| α-helix | 903 | 1 | |
| β-strand | 904-910 | 7 | 5 |
| α-helix | 919-930 | 12 | |
| β-strand | 937 | 1 | 6 |
| α-helix | 938-939 | 2 | |
| β-strand | 940-945 | 6 | 5 |
| β-strand | 952-957 | 6 | 5 |
| β-strand | 963 | 1 | 6 |
| α-helix | 964-970 | 7 | |
| α-helix | 977-996 | 20 | |
| β-strand | 999-1000 | 2 | 7 |
| α-helix | 1006-1008 | 3 | |
| β-strand | 1009-1013 | 5 | 6 |
| β-strand | 1016-1019 | 4 | 6 |
| β-strand | 1026-1027 | 2 | 7 |
| α-helix | 1028-1029 | 2 | |
| β-strand | 1034-1036 | 3 | 8 |
| α-helix | 1045-1047 | 3 | |
| α-helix | 1050-1055 | 6 | |
| β-strand | 1057-1059 | 3 | 8 |
| α-helix | 1060-1075 | 16 | |
| α-helix | 1080-1082 | 3 | |
| α-helix | 1084-1092 | 9 | |
| α-helix | 1097-1099 | 3 | |
| α-helix | 1100-1109 | 10 | |
| α-helix | 1114-1117 | 4 | |
| α-helix | 1122-1129 | 8 | |
| α-helix | 1130-1132 | 3 | |
| α-helix | 1142-1153 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tyrosine-protein kinase JAK1 | A, B | protein | 302 | Homo sapiens | P23458 (AlphaFold model) |
>6RSH_1 Tyrosine-protein kinase JAK1 (chains A, B) GDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKP ESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNK NKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDK EYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMI GPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEAL LK
| ID | Name | Formula | Copies |
|---|---|---|---|
| KHE | 1-[(3~{R},4~{R})-4-(cyanomethyl)-3-fluoranyl-1-[(4-phenylphenyl)methyl]piperidi… | C28 H29 F N6 O2 | 2 |
Structure based optimization of JAK1-ATP binding pocket Inhibitors in the aminopyrazole class. Zak, M., Gibbons, P., Brown, D.G. To be published.
Other PDB entries of the same protein (UniProt P23458 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6RSH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.